KEGG   Meleagris gallopavo (turkey): 100548803Help
Entry
100548803         CDS       T01523                                 

Gene name
AOX1
Definition
aldehyde oxidase 1 (EC:1.2.3.1)
Orthology
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100548803 (AOX1)
   00350 Tyrosine metabolism
    100548803 (AOX1)
   00380 Tryptophan metabolism
    100548803 (AOX1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    100548803 (AOX1)
   00760 Nicotinate and nicotinamide metabolism
    100548803 (AOX1)
   00830 Retinol metabolism
    100548803 (AOX1)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    100548803 (AOX1)
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     100548803 (AOX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 1339 aa AA seqDB search
MSLQGAVGAAELVFYVNGRKIIEKNADPEQMLLFYLRKRLRLTGTKYGCGGGGCGACTVM
ISTYEPASKKIRHYSANACLLPICSLYGMAVTTVEGVGSTRTRIHPVQERLAKCHGSQCG
FCTPGMVMSIYTLLRNHPEPTYEQMTAALAGNLCRCTGYRPILDACKTFCKDSVCCQSKA
NGRCCLDQEEDLSGREEKESARLFSPDEFEPLDPTQEFIFPPELMRMAENQPKRTLVFHG
ERMMWISPVTLDELQDLKAAHPKAPLVVGNTGVGPDMKFRGVFHPIIIAPARIPDLNVVK
CMSDGLTIGAACSLSVMKDILRNAVLELPEEKTKIFYAVLQQLRTLGGEQIRNVASLGGN
IISRKSTSDLNPILAAGNCMLNLASQGGKRWIPLSDIFANGVGNNTIRPEEVLVSVHIPH
SRKGEYISAFRQAPRRENALPIISAGMRVLFEEGTDKIKDLSIFYGGAASTTICAKQTCQ
TLIGRYWNEEMLDEASRLILNEIVLPDSAWDGKVEYKKILIVSFFYKFFLEVLQSLKTMD
PCHYPGIPMEYESVLENFQTKMPQSIQIYQNVELSQSPQDPVGRPIMHQSGIKHATGEAV
YIDDIPAVDGELFLAVVTSSRAHAKIVSVDTSEALKEPGVFDVITANDVPATNEFHYSDD
PEIIFARNKVICVGQIVCAVAADSYAHAKQAAAKVKIEYEALEPVILTIEDAIKHNSFFE
PKRKLEHGDVDKAFETVDHILEGTGEIHIGGQEHFYMETQSVLAIPKGEDKEMDVFVSTQ
HPAFIQEMVAASLGVPANRIMCHVKRVGGAFGGKLLKAGLLASVASVAANKTNRAVRLIL
SRGDDMLITGGRHPFIGKYKVGFMNDGRIRAVDAKYYINGGCTPDESVLVAEVSILKMDN
AYKIPNLRCWASACKTNLPSNTAFRGFGFPQSGLVTETWITEVAEKTGLSPEKVREINMY
KEDEQTHFKQKLDPQNLIRCWNECMEKSAYYGRKTAIEEFNKQNYWKKKGIAIVPMKFPF
GLGSRYLSQAAALVHIYTDGSVLLTHGGIELGQGIHTKMIQVASRELNIPMSYIHFCETS
TTTVPNACASVGSAGTDVNGMAVKDACQTLLKRLQPIINENPKGNWNDWIKKAFEQSVSL
SATGYFRGYDANMDWEKGEGQPFTYFLYGTACSEVEINCLTGDHKNLRTDIVMDIGCSIN
PAVDIGQIEGAFVQGIGLYTMEELKYSPEGVLRTRGPDQYKIPAVCDIPEQFNVSLLSSS
QNPYAIYSSKGLGEAGLFLGSSVFFALRDAITCVRNERGLKKTFALNSPLTAEQIRAACT
DDFTKMVIGRWGSDLFNYV
NT seq 4020 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgcaaggggcggtaggggctgcggagttggttttctatgtgaatgggagaaag
ataatagagaaaaatgccgatcctgaacagatgctgctgttttatctgcgaaagagactc
cgtcttacaggaactaagtatggctgtggaggaggtggctgtggtgcctgcacagtgatg
atatcaacttatgagccagcttcaaagaagatacgacactactcagcaaatgcatgcttg
cttcccatttgctcattgtatggtatggcagtcaccacagtggaaggtgttggaagtaca
agaaccagaattcatcctgttcaggaaaggcttgccaagtgccatggctcccagtgtggt
ttctgtacccctggaatggttatgtccatatacactttgttaagaaaccacccagaacca
acttacgagcagatgactgcagctctggctgggaacttgtgccgctgtactggatacagg
cccatcctagatgcctgtaaaaccttctgtaaggattctgtttgttgtcaaagtaaagca
aatggaaggtgttgcttggatcaagaagaggacttatctggcagagaagagaaggaatct
gccagactgttttcaccagatgaatttgagcccttagatcccacccaggagtttatattt
cctccagaactaatgagaatggctgaaaatcaaccgaaaaggactctggtttttcatggg
gaacgaatgatgtggatttctcctgtaaccttagatgaattacaggatctgaaagctgcc
caccccaaagcacctcttgttgttggaaacaccggtgtgggacctgatatgaaatttaga
ggcgtgttccatccaattatcatcgctcctgccaggatcccagatctgaatgtggtgaaa
tgcatgagtgatggattaactataggagctgcctgcagcctctctgtaatgaaagacatc
ttgagaaatgcagttttggagttgcctgaagagaagacaaagattttctatgcggtcttg
cagcagttaagaacactgggtggagaacagataagaaatgttgcttcattaggtggaaac
attataagtcgaaaatcaacctcagacttgaatcctattctggcagctggcaattgtatg
cttaatctggcttcacaaggaggaaagaggtggattcctttaagtgatatttttgcaaat
ggagttggtaacaatactattaggccagaagaggttttagtctctgtccatattccccat
tctaggaagggagagtatatctctgcatttagacaagcaccgagaagagaaaatgctctt
ccaataattagtgctggaatgagagtcctttttgaagaaggtacagacaaaattaaggat
ttgagcattttctatggaggtgctgcttcaacaacaatctgtgcaaagcaaacctgtcag
acacttattggaagatactggaatgaagagatgttggatgaagcttccaggctaatcctc
aatgaaatagttctcccagactcagcctgggatgggaaagtagaatataaaaaaattttg
atagttagtttcttctacaagtttttcctggaagtattacagtccttgaagacaatggac
ccttgtcactatcctggcatacctatggaatatgagagtgttctagaaaacttccaaacc
aaaatgccccagagtatccaaatatatcagaatgtagagctgagtcagtctccccaggat
cctgtgggacggcctattatgcaccagtctggaattaagcatgccactggtgaagcagtt
tacattgatgatattcctgctgtggacggagagctcttcctggctgttgtcactagttcc
agagctcatgctaagattgtatctgtagatacctcagaggctctgaaggaaccaggtgtg
tttgatgtcataacagctaatgatgtaccagctacaaatgagtttcactattctgatgat
ccagagattatatttgcaagaaacaaggtaatttgtgttggtcagattgtatgtgctgta
gctgcagattcatatgctcatgccaaacaagctgctgcaaaagtgaagatagagtatgaa
gcgctggaacctgtgatcttgacaattgaggatgctattaagcacaattcattctttgag
ccaaaaagaaaattagaacatggagatgttgataaggcatttgaaactgttgatcatata
cttgaaggaacaggggagattcacattggaggacaggaacacttttatatggagactcag
agtgtccttgctattccaaaaggagaggataaagaaatggatgtgtttgtttcaacgcaa
catccagcatttatccaggagatggtagctgcaagtctaggcgttccagcaaacaggatc
atgtgccatgttaaacgagttggtggagcttttggtgggaagctcctgaaagctggttta
ctggcatcagttgcttcagtggcagcaaacaaaaccaacagagcagtccgtcttattctg
agccggggagatgatatgttaatcactggtggccgacatccttttattggcaaatataaa
gttggcttcatgaatgatggtagaatcagagctgtggatgccaagtattacattaatggt
ggatgcacccctgatgaatctgttctggtagcggaagtatccatattaaaaatggacaat
gcatataagattcccaacttgagatgctgggcttctgcttgcaaaacaaacttgccatca
aacacagcatttcgagggtttggttttcctcagtcaggactggtgacagaaacttggata
acagaagttgcagagaaaacaggtttatcgccagaaaaggttagggaaataaatatgtat
aaggaggatgagcaaacacacttcaaacaaaagcttgatccacaaaacttaatacgttgt
tggaatgaatgtatggagaaatctgcatactacggtagaaaaacagctattgaagaattc
aacaaacaaaattactggaagaaaaaagggattgccattgttccaatgaagtttccattt
ggactaggctcacgttacctttctcaggctgctgctctggttcatatttatacggatgga
tctgtgcttttgacacatggtggaattgaattgggacagggtattcatacaaaaatgatc
caggttgctagtcgggaattaaacatcccaatgtcatatattcacttctgtgaaacaagc
acaacaactgttcctaatgcatgtgcttcagtaggatctgcagggacagatgtcaacggc
atggctgtaaaggatgcttgccaaactcttctgaaacgcctgcagcctatcattaatgag
aacccaaaaggcaactggaatgattggattaaaaaagcctttgaacaaagtgtgagtctt
tcagctactggctactttagaggttatgatgcaaatatggactgggagaaaggggaagga
cagccattcacgtactttctttatggaactgcttgttcagaggttgaaattaactgttta
acgggagatcacaagaacctcagaacagacatagttatggacattggatgcagcataaat
ccagctgtggatataggacagattgaaggtgcctttgttcaaggcattggactttacaca
atggaagaattaaagtactctccagaaggagtcctacgtactcggggtccagatcagtat
aagatccctgctgtttgtgatattccagaacaatttaatgtttctctactgtcatcttcc
caaaatccttatgccatctattcatcaaaggggttaggtgaggcgggacttttcttggga
agctctgtgttcttcgcattgagagatgcaataacttgtgtgaggaatgaaagaggacta
aaaaagacctttgcactgaacagccctctgactgctgaacaaatacgagcagcctgcaca
gatgacttcactaaaatggtaataggaaggtgggggagtgatctgtttaattatgtctaa

DBGET integrated database retrieval system