KEGG   Meleagris gallopavo (turkey): 100548964Help
Entry
100548964         CDS       T01523                                 

Gene name
TESK2
Definition
testis-specific kinase 2
Orthology
K08842  
testis-specific kinase 2 [EC:2.7.12.1]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100548964 (TESK2)
Protein kinases [BR:mgp01001]
 Serine/threonine protein kinases: TKL group
  LISK family [OT]
   100548964 (TESK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
10
AA seq 673 aa AA seqDB search
MDRSKRNSIAGFPPRLERAEDFDGGTGGDGTTSQIGRVWTSSYRALISAFSRLTRLDDFT
CEKIGSGFFSEVFKVRHRTSDQVMALKMNTLNSNRANMLKEVQLMNRLSHPNILRFMGVC
VHQGQLHALTEYINYGNLEQLLDSNQHLPWTVRVKLAYDIAMGISYLHYKGIFHRDLTSK
NCLIKHDENGYSAIVGDFGLAEKIPDMSMCSEKLPVVGSPFWMAPEVLRDEPYNEKADVF
SYGIILCEIIARIQADPDYLPRTENFGLDYDAFQHMVGDCPPDFLQLAFNCCNMDPKLRP
SFADIVKTLEETLNRLRNEDSERDRKFLNLDNNERKPKGSIEKGPGVKRLSSLDDKIPPK
SPRPRRNIWLSRSQSDIFSRKPSRKINVQDPYYTPNKGLGRKVNPFSAREDLKGGKIKFF
DMPSKSVISLVFDLHSPEAGGCLKASQSQFRQAYSTDWQEFSLLPGRRCRSLPVSPELAH
KEYGLFSGLSSTISRCDPTQLSAEVRQKLLSSSKYGVSEIPPFQAKPHRPEFLSVPGQEE
DMDCSDGPVSQEENGFYSENTCENPARNQPLVLAQSEPLSYKGLPVENSLNSEEHSSHVF
AGCLPSEEMEVEDNLLKNTLLESTKPLFSVSPSTELRTDARPFREHDGDSTVPLSQTSSN
ISASGSTRPTCDI
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atggaccgaagtaaaaggaattcaatagctggatttccacctcgcttggagcgtgctgag
gactttgatggtggcactggaggagatgggactacatcccagatagggagagtttggacc
tcttcgtacagagccctgataagtgccttttccagacttacccgtctcgatgacttcacg
tgtgagaaaattggctctggtttcttctctgaggtgttcaaggtaagacacagaacttca
gaccaggtaatggctttgaagatgaacacgctgaacagcaacagagcgaacatgctgaaa
gaggttcaacttatgaatagactctcacatccaaacatcttaaggtttatgggtgtctgt
gtgcatcaaggacagctgcacgcacttactgagtacatcaactatggaaacctggagcag
ctattagacagcaaccagcatctgccttggacagtgagggtgaaattggcatatgacatc
gctatgggaatcagttatcttcactacaaaggcattttccatcgagaccttacatccaag
aactgtttaataaaacacgatgagaatggatactcagcaatagtgggagactttggttta
gcagagaaaattccagatatgtctatgtgtagtgagaagttaccagtggtggggtcacct
ttctggatggcaccagaagttctcagagatgaaccttacaatgaaaaggcagatgtgttc
tcctatggtataattctgtgtgagataatagcaagaatacaggcagatccggactatctc
cctcgcacagagaattttggattagattatgatgccttccagcacatggtgggagactgt
ccccctgacttcctccagctggcgttcaactgctgtaatatggatccaaagctgcgtcct
tcgtttgctgatattgtcaaaacactggaggagactttaaaccgcctgagaaacgaggat
tctgagagagacaggaagtttttgaatcttgacaacaatgagagaaaacccaaagggtca
attgaaaaaggaccaggagtaaaacgtttgagttccctggacgataagattccacccaag
tcaccccgtccacgtcggaatatctggttgtcacgtagccagtcggatatcttctctcgc
aagccttccaggaagataaatgtgcaggacccctactacacaccaaacaaaggattaggc
cggaaagttaatcccttcagtgcccgggaggacctcaagggtggaaagataaaattcttt
gacatgccaagcaagtctgtgatctctcttgtgtttgacttgcattctccagaggcaggt
ggttgcctgaaagccagccagtcccaattccggcaggcatatagcacagactggcaggaa
ttttccctccttcctgggaggagatgcagatcacttccagtctctcctgaattggcacac
aaagaatatggcctgtttagtggactgtcttcaaccatcagtagatgtgatccaacccag
ctaagtgcagaggttcggcaaaagctcctgagtagcagtaaatatggtgtgtcagagatt
ccaccctttcaagccaagcctcacaggccagaatttctttctgtaccaggacaagaggag
gatatggactgttcggatgggccagtgtcccaggaggaaaatggattttactctgagaac
acatgtgagaatccagcacgtaatcaaccattagtgctggcccagtcagagccattatct
tacaaagggctgccagtcgagaattcattgaactcagaggaacactcctcacatgtgttt
gctggttgtctcccttctgaagagatggaggtggaagacaacctgctgaaaaacacactg
ctggagtctacaaagcctctgttcagcgtctctccttccacggagctgaggacagatgca
cggccattcagggagcacgatggggacagcactgtcccgttgtctcagacgtcctccaac
atctcagcaagtggcagcacacggccaacttgtgacatatga

DBGET integrated database retrieval system