KEGG   Meleagris gallopavo (turkey): 100549018Help
Entry
100549018         CDS       T01523                                 

Gene name
PFN2
Definition
(RefSeq) profilin 2
  KO
K05759  
profilin
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100549018 (PFN2)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100549018 (PFN2)
Exosome [BR:mgp04147]
 Exosomal proteins
  Proteins found in most exosomes
   100549018 (PFN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 204 aa AA seqDB search
MSPGVLAMRGLPGSGGVRLRAATKRCCVNCSQQSAAPGGNAPSDPQPERGNGNNGTEPQD
NAVLTPGFFLWQPVEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKS
QGGEPTYNVAVGRAGRGSNLGNNYRACEGAMLAVSVCLPVTSAGECCILLGALPPSLQDN
WELHHRGAVIRGGSALKSCLHFVL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgagccccggtgtcctggcgatgcgggggttgccggggagcggcggtgtgcggcttcga
gcggcgacaaagcgctgctgcgtgaactgttcgcaacaaagcgctgcgccggggggaaat
gcgccatccgaccctcagccggagagggggaacggtaataacggaacggagccgcaggac
aacgcggtgctgactcctggctttttcctttggcagccagtagaaatagatatgattgta
gggaaggaccgggagggtttcttcaccaatggcctgaccctcggggcaaagaagtgctct
gtgatcagagacagcctctacgtggacggggactgcacgatggacatccggacgaagagc
caaggcggggagccgacgtacaatgtggccgtgggcagagctggtcgaggatctaacttg
ggaaacaattaccgcgcttgtgaaggcgcgatgctggctgtgtccgtgtgcctgccagtg
acctctgccggcgagtgctgcatcctgctgggagccttaccgccttctttgcaagacaat
tgggagcttcaccaccgcggcgcagtgattagaggggggtcagcgttaaagtcctgcctg
cactttgtcttatga

DBGET integrated database retrieval system