KEGG   Meleagris gallopavo (turkey): 100549125Help
Entry
100549125         CDS       T01523                                 

Gene name
FLNB
Definition
(RefSeq) filamin B, beta
  KO
K04437  
filamin
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100549125 (FLNB)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100549125 (FLNB)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100549125 (FLNB)
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100549125 (FLNB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
14
AA seq 2628 aa AA seqDB search
MPAPEKDLAEDAPWKRIQQNTFTRWCNEHLRCVNKRIGNLQHDLSDGLRLIALLEVLSQK
RMYRKYHQRPTFRQMQLENVSVALEFLERESIKLVSIDSKAIVDGNLKLILGLIWTLILH
YSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWETWDPSKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKA
KLKPGAPLKPKLNPKKARAYGRGIEPHGNMVKQPAIFTVDTISAGQGDLMVFVEDPEGNR
EEAKIMPSSDKNKTYSVQYMPKVTGPHKVSVLFAGQHISKSPFEVNVDKAQGDASKVTAK
GPGLEATGNIANKPTYFDLYTAGAGVGDVIVEVEDPQGRCLAEVAVEDKGNQVYRCVYKP
VQAGPHVVKVTFAGEAIPKTPCNVLIGEACNPNACRATGRGLQPKGVRIRETADFKVDTR
AAGSGDLGVTIKGPKGLEELVKQKGFMDGVYAFEYYPATPGKYIVTITWGGHNIPKSPFE
VHIGHEAGPQKVRAWGPGLHEGIVGKSADFVVESIGTEVGSLGFAIEGPSQAKIECDDKN
DGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIRPASGDFNPDKVRAYGPGLERSGC
IVNNLAEFTVETKDAGKAPLKIYAQDGEGNPIDIQMKSKPDGVFACSYVPVKPIKHTISI
VWGGANVPNSPFRVLIGQGSHPQKVKVFGPGVERTGLKASEPTHFTVDCTDAGEGDVSVG
IKCDARVVSDEEEDIDFDIIHNANDTFTVKYAPPAAGRYTIKVLFAGEEIPASPFRVKVD
PSHDASKVKAEGPGLSKTGVENGKPTHFTVFTKGAGKAPLDVQFSSPVSGEVVADVDIID
NYDYSHTVRYTPIQQGPVKVLVTYGGDPIPKSPFTVGVAAPLDLSKVKVNGLENRVEVGK
DQEFVIDTRGAGGQGKLDVNISSPMRKAVPCLVEPVLGKECSTAKYIPREEGLYVVDVSY
DGNPIPGSPYTVEATLPPDPSKVKAHGPGLRGGLVGKPAQFTIDTKGAGTGGLGLTVEGP
CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDVSKVIATG
PGLERGKVGEAGLLNVDCTEAGPGNLRVDIVSDTGSKAEIQIDDNKDGTYVVTYVPLSAG
MYTIKMKYGGEQVPKFPARVKVEPAVDTSRVKVFGPGVEGKDVFREATTEFTVDARPLTK
AGGDHIRTQITSPSGSPTDCQIQDNADGTYAVEYTPFEKGPHTVSVTYDGVPVPNSPFRV
NVTEGCHPSRVKAQGPGLKEAFTNQPNAFSVVTRGAGIGGLGITVEGPSESKISCKDNKD
GSCSAEYVPYVPGDYDVNITYGGEHIPGSPFKVPVKDVVDPSKVKIAGPGLGTAVRAKIP
QSFTVDTSKAGAAPLEVVVAGPRVDETDSQGWRSPLKNISDFLKGDPKGIVEPVNVVDNG
DGTHTVVYTPTQEGPYMISVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSSYGIPAS
LPVEFAVDAKDAGQGLLTVQITDQEGKPKRVDIHDNKDGTYTVTYVPDKTGRYTIGVKYG
GDDIPSSPYRIRASPAGDASKCLATGPGIAPTVRTGEEVGFVVDAKSAGKGKVTCTVLTP
DGTEAEADVVENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMAVDADDAAVRSQ
ETVGASPPGFRPWVTEEAYVPVGDMNGMGFRPFDMVIPFAVRKGEITGEVHMPSGKTDTP
DIVDNKDGTVTVRYAPTEVGLHEMHIKYMGNHIPESPLQFYVNYPNSGSVSAYGPGLIYG
VANKPATFTIVTEDAEEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGNYSILVKY
NDKHIPGSPFTAKITDDNRRRSQVKLGSAAEFLLDINETDLSLLTASIKAPSGRDEPCLL
KRLPNNHIGISFIPREVGEHLVSIKKNGNHVPNSPVTIMVVQSEIGDARRARVYGRGLVE
GRTFEMCDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTK
FADEHIPGSPFTVKISGEGRVKESITRTRRAPSVATVGSICDLNLKIPEIDCGDMTAQVT
SPSGRNSDAEIVEVDKNTYCVRFVPQEMGVHTVDVKYRGQPVPGSPFQFTVGPLGEGGAH
KVRAGGPGLERGETGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDHKDGSCGVSYIV
QEPGNYEVSIKFNDEHIPESPYLVPIIAPSDDARRLTVTSLQESGLKVNQPASFAIRLNG
AKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGIHSIDVKFNGSHVVGSPFKVR
VGEPGQAGNPTLVTAYGPGLESGTTGLQSEFFINTTKAGPGTLSVTIEGPSKVKMDCQET
PEGYKVMYTPMAPGNYLIGVKYGGPNHIVGSPFKAKVTGQRLVTLGSANETSSIMVESVT
RSSTETCYSAIPKSTSDASKVVSRGAGLSKAFVGQKSSFSVDCSKAGSNMLLVGVHGPTI
PCEEVSIKHLGNHQYNVTYVVKERGDYVLAVKWGDEHIPGSPFHVTVP
NT seq 7887 nt NT seq  +upstreamnt  +downstreamnt
atgccggcccccgagaaggacctggcggaggacgcgccctggaagcggatccagcagaac
accttcacccgctggtgcaacgagcacctgcgctgcgtcaacaagcgcatcggcaacctg
cagcacgacctgagcgacgggctgcggctgatcgcgctgctcgaggtgctcagccagaag
cgcatgtaccgcaagtaccaccagcggcccaccttccgccagatgcagctggagaacgtc
tccgtcgccctcgagttcctggagcgtgagagcatcaagctggtctccatcgatagtaaa
gccatagttgatggaaacttgaagttgatccttggtctgatatggaccctcatcctccac
tactcgatttccatgcctgtgtgggaggatgagggtgatgacgatgcaaagaagcagacc
cccaagcaaaggctgctgggctggattcagaacaaaatcccttacctacccatcacaaac
ttcaatcagaactggcaggatggcaaagcacttggggctctcgttgacagctgtgctcca
ggcctgtgccctgactgggagacctgggacccaagcaagcctgttgacaacgctcgtgag
gccatgcagcaggcggatgactggctgggcgtgccgcaggttattactcctgaggaaatt
atccaccctgatgtggatgaacactctgtaatgacttacctgtcacagttccctaaagcc
aagctgaagccaggagctcctttaaaacccaaactgaatccaaagaaagcaagagcttat
ggcagaggaattgaacctcatgggaacatggtgaagcagcctgccatcttcacggtagac
accatcagtgctgggcagggagacctgatggtctttgtagaggatccagaaggaaacagg
gaagaggcgaaaataatgccatccagtgacaaaaacaagacctattcagttcagtacatg
ccaaaggttactggacctcacaaggtttcagtcctatttgctggacaacacatctcaaag
agtccttttgaagtgaacgttgacaaagcccagggagatgcaagcaaagtaacagcgaag
ggtccaggactggaggcaacaggaaacattgccaacaagcctacctactttgatctctac
acagcaggtgctggtgtgggtgacgtgatcgtggaagtggaggatcctcagggaagatgc
cttgctgaagttgcagtagaagacaaaggcaaccaagtctatcgttgtgtctacaaacct
gtccaagctggtcctcacgttgtcaaagtgacttttgcgggggaggcaattcccaaaact
ccttgcaatgttctcattggagaggcctgcaatccgaatgcttgtcgtgccaccggtaga
ggcctgcagcccaaaggcgtccgcatcagagaaacagccgacttcaaggttgatacgaga
gcagcaggcagcggagaccttggggtgactattaaaggaccaaagggcttggaggagctt
gtgaaacagaaaggctttatggatggtgtatatgcgtttgaatattatccagctacccca
gggaaatacattgtgacgattacgtggggtggacacaacatcccaaaaagcccctttgaa
gttcacataggtcatgaagcaggccctcagaaagtacgagcctgggggccaggactgcat
gaagggattgtgggcaagtcggctgacttcgtggttgagtccattggcacagaagttggt
tctcttggctttgcaatagagggtccttctcaggctaaaatagagtgtgatgacaagaac
gatggctcatgcgatgtgaagtattggcccaaagagccaggtgaatacgctgtgcacatc
atgtgtgatgatgaagatataaaggacagcccctacatggccttcatccgaccggcgtca
ggagacttcaacccggataaggtgagggcttacggtccaggcttggagagaagtggctgc
atagtgaacaatcttgctgagttcacagttgaaaccaaggatgctgggaaagcacctctg
aagatatatgcacaggatggagaaggaaaccctattgatatccagatgaagagcaagcct
gatggcgtgtttgcctgttcctatgtgccagttaaaccaatcaaacatactatttctatt
gtctggggaggagccaacgtgcccaatagtccgtttagggtcctgataggtcaggggagc
catcctcagaaagtgaaagtgtttgggcctggagtggagagaactggcctgaaagcgagt
gagccaactcacttcactgttgactgcacagatgctggagaaggtgatgtcagtgttgga
attaagtgtgatgctcgtgttgtcagtgatgaagaggaagacatagattttgacattatc
cacaatgctaatgatacgttcacagtgaagtatgcaccacctgctgccggacgctacact
attaaagtgctttttgcaggagaggaaattcctgccagtcctttcagagttaaagtggac
ccctctcacgatgccagtaaagtgaaagctgaaggacctgggctgagcaaaactggtgtg
gaaaatggcaagccaacccacttcactgtgttcactaagggagctggaaaggcgcccctg
gatgtgcagttcagcagccctgtgtcaggagaggtggtggcagatgtggacatcattgac
aactacgactattcccacactgttcggtacactccaatacagcagggaccagtgaaggtt
ctggtaacgtacggtggagatcctatccctaaaagccctttcactgtgggagttgctgct
ccgttagacttgagcaaagttaaagttaatggacttgaaaacagagtggaagtagggaag
gatcaagaatttgtaattgacaccagaggagctggtggacaaggtaaactggatgttaat
atttccagtcctatgaggaaagctgtaccatgcctggtggagccagttttgggtaaggag
tgcagtacagcaaaatacatcccaagagaggaaggattgtacgtggtggatgtgagctac
gatggcaatccaatcccaggcagcccctatactgtggaggccactctgcctcctgatccc
tccaaggtaaaagctcacgggccaggtcttcgaggaggcctcgttggaaaaccagctcaa
tttacgatagataccaaaggggcaggaactggaggtttgggtttgacggtggaaggccca
tgtgaagctaagattgaatgctcagacaatggtgatggaacctgctctgtctcctatctg
cctaccaagcctggagagtactttgtaaacatcctctttgaagaggttcacattcctggt
tcaccattcaaagcagacatagaaatgccatttgatgtctctaaagtcatcgccacaggt
ccaggtcttgaacgtggcaaagtaggtgaggcagggctcctgaatgttgactgtacagaa
gcgggtcctggtaacctgcgggtggacatagtgtcggatactggttccaaagctgagatc
cagattgatgataacaaggatgggacctatgttgtgacatatgtgccgctctcagctggc
atgtacacaatcaagatgaaatatggaggagagcaagtgcctaaattccctgcccgggtg
aaagtggagccagctgtggacacaagcagagttaaagtgtttgggccaggagtggaaggg
aaagatgtcttccgagaagctacaacggagttcactgtggatgcccgacctctaacgaaa
gctggtggtgaccacatcaggacacagatcacaagcccatccggctcccccacagactgt
cagatccaagacaatgctgatgggacgtacgcagtggagtacacgccatttgaaaagggt
ccacacacagtcagtgtaacatatgatggcgtgcctgtgccaaacagtcccttcagagtg
aatgtgacggagggctgccatccatcacgtgttaaggcacaaggacctggactcaaagaa
gctttcacaaatcagccaaatgccttttcagttgtcaccagaggggcaggaattggtggc
cttggaataactgttgagggaccttcagagtctaaaatcagctgtaaagacaacaaggat
gggagctgcagtgctgagtacgttccttatgttccaggagactacgatgtcaatattacg
tacgggggagaacatattcctggcagtcctttcaaggttcctgtgaaggatgttgtggat
cccagcaaggtgaagattgcaggaccaggcctgggaacagctgttcgagccaaaatcccg
cagtcctttactgtggacaccagcaaggcaggagcggcacccctggaggtggtggtggca
ggacccagagtggatgagacggattcccagggatggcgctctccattgaaaaacatttcg
gattttcttaagggtgatccaaagggaattgtggagcctgttaatgtagtagacaacgga
gatggcacccacacagtggtgtacacccctacacaggagggaccatacatgatctctgtc
aaatatgcagacgaagagattcctcgcagccccttcaaggtgaaggtgcttcctacatat
gatgccagtaaagtgacagcaagtggaccaggtctcagttcctatggcataccagccagt
ctgcctgtggagtttgctgtagatgctaaagatgccgggcagggacttctcactgtgcag
ataactgaccaagagggtaagcccaagagagtggacattcatgacaacaaggatggcaca
tacacagtgacctacgtccctgacaaaacgggccgctatacgattggtgtgaagtacggt
ggggatgacatcccatcctctccctaccgaatccgggcgtctccagcgggggatgccagc
aagtgtttggccacaggtcctggaattgcacccacagtgaggactggtgaggaggttggt
tttgtggtggatgccaaatcagcagggaaaggaaaagtgacgtgcaccgtcctgacacca
gatgggacagaagctgaggcagatgttgttgaaaacgaggacgggacttatgatatcttc
tacacagctgccaaaccaggaacctacgtgatttacgtccgcttcggtggggtagacatt
cccaacagtcctttcactgtgatggctgtagatgcagatgatgctgctgtgcggtcgcag
gagacagtgggtgcatccccacccggattccgcccttgggtcacagaagaggcttatgta
ccagttggcgacatgaacggcatgggattccggcccttcgatatggttatcccctttgct
gtaaggaaaggagaaataacaggtgaagtacacatgccctccggaaagactgatacacca
gacattgtggataacaaggatggtactgtaacagtgagatacgctcctacagaagtgggg
ctgcatgagatgcacataaaatacatgggaaatcacatcccagagagccctctacagttc
tatgtgaattatccaaacagcggcagcgtgtctgcttatgggcctggcctcatttatggg
gttgctaataaaccagcgacctttaccattgtcacggaagatgcagaggagggtggactg
gacttggctattgaaggaccttccaaagcggagatcagctgcattgataacaaagatggg
acgtgcacagtcacctacctgcccactctacctgggaactacagcatactggtcaagtac
aatgacaagcacatccctggcagcccattcacagccaagattacagatgataacagaaga
cggtcccaagttaagcttggatctgctgctgagtttttgttggatatcaacgagactgat
ctcagtctcctgacagctagcattaaagccccatcaggtcgtgatgaaccttgtcttctg
aagaggctgcccaacaaccacattggtatctcattcatcccacgggaagtaggagaacat
ctggttagcatcaagaaaaatgggaaccatgtaccaaacagccctgtaacaatcatggtg
gtccagtctgagataggagatgccagacgagcaagagtttatggacgtggattggtagaa
gggcgaacctttgaaatgtgtgactttattgtagacacaagagatgcaggttatggtggg
atctcgctggcagttgaaggacccagcaaggtagatatccaaactgaagacctagaagat
ggaacttgcaaagtatcctattttccaactgtacctggcgtgtacattgtgtccactaaa
tttgcagatgaacatattccaggcagcccatttactgtgaagataagtggtgagggaaga
gttaaggagagcatcacacgaacaagacgggctccctctgttgcaacagttggaagcata
tgtgatctgaacctaaaaatcccagaaattgactgtggggacatgacagcccaggtaact
agtccctctggaagaaactccgatgcagaaatagtagaagttgacaaaaacacctactgt
gtccgctttgtgccacaagaaatgggggtccacacagtagatgtcaaatacagagggcag
cccgtgccaggcagccccttccagttcactgtggggccactcggcgaaggaggagcccat
aaagtgagagctggaggcccagggctggaacgtggagagacaggtgtcccagctgagttc
agcatatggacacgggaggctggagctggaggactgtccattgctgtagaaggtccaagt
aaagcagaaattgcctttgaagaccataaagatggatcttgtggtgtatcttacatagtt
caagagccaggcaactatgaggtgtccataaagttcaacgatgagcacattcctgaaagc
ccctacctggttcccatcatcgccccgtctgatgatgctcgcaggctcactgtcactagc
cttcaggagtctggattaaaagttaatcagccggcatcctttgctataaggctgaacggg
gcaaagggcaagattgatgctaaagtccacagcccctccggagctgtagaagagtgccat
gtgtctgagctggagccagacaaatatgccgttcggtttatcccccacgaaaatggcatc
cactccatcgatgtgaagttcaacgggagccacgtggtgggcagccccttcaaggtgcgt
gttggtgagcccggccaggcgggcaaccccacgctcgtcacagcgtatggaccaggcctg
gagagcggcaccacgggattgcagtcggagtttttcattaacacgaccaaggctggtcca
ggtaccctctctgttacaattgaagggccatcaaaggtgaaaatggactgccaggaaact
ccagaaggttacaaagtcatgtacacacccatggctccgggaaactatttaattggagtt
aaatatggtggacctaaccacatagtgggcagccccttcaaggcaaaggttacaggacag
cggctggtcaccctgggcagcgcaaacgaaacctcttccatcatggtggagtcggtgacg
aggtcatcgaccgaaacttgctatagtgccattcccaaatccacctcggatgccagcaaa
gtggtttcccggggagcaggactctcaaaggcttttgtgggtcagaaaagctccttctct
gtggactgcagcaaagcaggttcaaatatgctgttagttggcgtccacggacctacaatc
ccatgtgaagaggtttccatcaagcatctgggcaaccaccagtacaacgtgacgtatgtg
gtcaaggagaggggtgactacgtcctggcagtgaagtggggtgatgagcacatccctggg
agccccttccatgtcacggttccctaa

DBGET integrated database retrieval system