KEGG   Meleagris gallopavo (turkey): 100549125Help
Entry
100549125         CDS       T01523                                 

Definition
filamin-B-like
Orthology
K04437  
filamin
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100549125
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    100549125
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100549125
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100549125
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 2185 aa AA seqDB search
AGVGDVIVEVEDPQGRCLAEVAVEDKGNQVYRCVYKPVQAGPHVVKVTFAGEAIPKTPCN
VLIGEDLCSSLLSYPPFVEFWTSLLMASYPFEVHIGHEAGPQKVRAWGPGLHEGIVGKSA
DFVVESIGTEVGSLGFAIEGPSQAKIECDDKNDGSCDVKYWPKEPGEYAVHIMCDDEDIK
DSPYMAFIRPASGDFNPDKVRAYGPGLERSGCIVNNLAEFTVETKDAGKAPLKIYAQDGE
GNPIDIQMKSKPDGVFACSYVPVKPIKHTISIVWGGANVPNSPFRVLIGQGSHPQKVKVF
GPGVERTGLKASEPTHFTVDCTDAGEGDVSVGIKCDARVVSDEEEDIDFDIIHNANDTFT
VKYAPPAAGRYTIKVLFAGEEIPASPFRVKVDPSHDASKVKAEGPGLSKTGVENGKPTHF
TVFTKGAGKAPLDVQFSSPVSGEVVADVDIIDNYDYSHTVRYTPIQQGPVKVLVTYGGDP
IPKSPFTVGVAAPLDLSKVKVNGLENRVEVGKDQEFVIDTRGAGGQGKLDVNISSPMRKA
VPCLVEPVLGKECSTAKYIPREEGLYVVDVSYDGNPIPGSPYTVEATLPPDPSKVKAHGP
GLRGGLVGKPAQFTIDTKGAGTGGLGLTVEGPCEAKIECSDNGDGTCSVSYLPTKPGEYF
VNILFEEVHIPGSPFKADIEMPFDVSKVIATGPGLERGKVGEAGLLNVDCTEAGPGNLRV
DIVSDTGSKAEIQIDDNKDGTYVVTYVPLSAGMYTIKMKYGGEQVPKFPARVKVEPAVDT
SRVKVFGPGVEGKDVFREATTEFTVDARPLTKAGGDHIRTQITSPSGSPTDCQIQDNADG
TYAVEYTPFEKGPHTVSVTYDGVPVPNSPFRVNVTEGCHPSRVKAQGPGLKEAFTNQPNA
FSVVTRGAGIGGLGITVEGPSESKISCKDNKDGSCSAEYVPYVPGDYDVNITYGGEHIPG
SPFKVPVKDVVDPSKVKIAGPGLGTAVRAKIPQSFTVDTSKAGAAPLEVVVAGPRVDETD
SQGWRSPLKNISDFLKGDPKGEAATGIVEPVNVVDNGDGTHTVVYTPTQEGPYMISVKYA
DEEIPRSPFKVKVLPTYDASKVTASGPGLSSYGIPASLPVEFAVDAKDAGQGLLTVQITD
QEGKPKRVDIHDNKDGTYTVTYVPDKTGRYTIGVKYGGDDIPSSPYRIRASPAGDASKCL
ATGPGIAPTVRTGEEVGFVVDAKSAGKGKVTCTVLTPDGTEAEADVVENEDGTYDIFYTA
AKPGTYVIYVRFGGVDIPNSPFTVMAVDADDAAVRSQETVGASPPGFRPWVTEEAYVPVG
DMNGMGFRPFDMVIPFAVRKGEITGEVHMPSGKTDTPDIVDNKDGTVTVRYAPTEVGLHE
MHIKYMGNHIPESPLQFYVNYPNSGSVSAYGPGLIYGVANKPATFTIVTEDAEEGGLDLA
IEGPSKAEISCIDNKDGTCTVTYLPTLPGNYSILVKYNDKHIPGSPFTAKITDDNRRRSQ
VKLGSAAEFLLDINETDLSLLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVS
IKKNGNHVPNSPVTIMVVQSEIGDARRARVYGRGLVEGRTFEMCDFIVDTRDAGYGGISL
AVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHIPGSPFTVKISGEGRVKE
SITRTRRAPSVATVGSICDLNLKIPEIDCGDMTAQVTSPSGRNSDAEIVEVDKNTYCVRF
VPQEMGVHTVDVKYRGQPVPGSPFQFTVGPLGEGGAHKVRAGGPGLERGETGVPAEFSIW
TREAGAGGLSIAVEGPSKAEIAFEDHKDGSCGVSYIVQEPGNYEVSIKFNDEHIPESPYL
VPIIAPSDDARRLTVTSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSE
LEPDKYAVRFIPHENGIHSIDVKFNGSHVVGSPFKVRVGEPGQAGNPTLVTAYGPGLESG
TTGLQSEFFINTTKAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLIGVKYG
GPNHIVGSPFKAKVTGQRLVTLGSANETSSIMVESVTRSSTETCYSAIPKSTSDASKVVS
RGAGLSKAFVGQKSSFSVDCSKAGSNMLLVGVHGPTIPCEEVSIKHLGNHQYNVTYVVKE
RGDYVLAVKWGDEHIPGSPFHVTVP
NT seq 6560 nt NT seq  +upstreamnt  +downstreamnt
gtgctggtgtgggtgacgtgatcgtggaagtggaggatcctcagggaagatgccttgctg
aagttgcagtagaagacaaaggcaaccaagtctatcgttgtgtctacaaacctgtccaag
ctggtcctcacgttgtcaaagtgacttttgcgggggaggcaattcccaaaactccttgca
atgttctcattggagaggatctctgctcatctctcctgagctaccctccatttgtggaat
tttggacttcactgctaatggcttcatacccctttgaagttcacataggtcatgaagcag
gccctcagaaagtacgagcctgggggccaggactgcatgaagggattgtgggcaagtcgg
ctgacttcgtggttgagtccattggcacagaagttggttctcttggctttgcaatagagg
gtccttctcaggctaaaatagagtgtgatgacaagaacgatggctcatgcgatgtgaagt
attggcccaaagagccaggtgaatacgctgtgcacatcatgtgtgatgatgaagatataa
aggacagcccctacatggccttcatccgaccggcgtcaggagacttcaacccggataagg
tgagggcttacggtccaggcttggagagaagtggctgcatagtgaacaatcttgctgagt
tcacagttgaaaccaaggatgctgggaaagcacctctgaagatatatgcacaggatggag
aaggaaaccctattgatatccagatgaagagcaagcctgatggcgtgtttgcctgttcct
atgtgccagttaaaccaatcaaacatactatttctattgtctggggaggagccaacgtgc
ccaatagtccgtttagggtcctgataggtcaggggagccatcctcagaaagtgaaagtgt
ttgggcctggagtggagagaactggcctgaaagcgagtgagccaactcacttcactgttg
actgcacagatgctggagaaggtgatgtcagtgttggaattaagtgtgatgctcgtgttg
tcagtgatgaagaggaagacatagattttgacattatccacaatgctaatgatacgttca
cagtgaagtatgcaccacctgctgccggacgctacactattaaagtgctttttgcaggag
aggaaattcctgccagtcctttcagagttaaagtggacccctctcacgatgccagtaaag
tgaaagctgaaggacctgggctgagcaaaactggtgtggaaaatggcaagccaacccact
tcactgtgttcactaagggagctggaaaggcgcccctggatgtgcagttcagcagccctg
tgtcaggagaggtggtggcagatgtggacatcattgacaactacgactattcccacactg
ttcggtacactccaatacagcagggaccagtgaaggttctggtaacgtacggtggagatc
ctatccctaaaagccctttcactgtgggagttgctgctccgttagacttgagcaaagtta
aagttaatggacttgaaaacagagtggaagtagggaaggatcaagaatttgtaattgaca
ccagaggagctggtggacaaggtaaactggatgttaatatttccagtcctatgaggaaag
ctgtaccatgcctggtggagccagttttgggtaaggagtgcagtacagcaaaatacatcc
caagagaggaaggattgtacgtggtggatgtgagctacgatggcaatccaatcccaggca
gcccctatactgtggaggccactctgcctcctgatccctccaaggtaaaagctcacgggc
caggtcttcgaggaggcctcgttggaaaaccagctcaatttacgatagataccaaagggg
caggaactggaggtttgggtttgacggtggaaggcccatgtgaagctaagattgaatgct
cagacaatggtgatggaacctgctctgtctcctatctgcctaccaagcctggagagtact
ttgtaaacatcctctttgaagaggttcacattcctggttcaccattcaaagcagacatag
aaatgccatttgatgtctctaaagtcatcgccacaggtccaggtcttgaacgtggcaaag
taggtgaggcagggctcctgaatgttgactgtacagaagcgggtcctggtaacctgcggg
tggacatagtgtcggatactggttccaaagctgagatccagattgatgataacaaggatg
ggacctatgttgtgacatatgtgccgctctcagctggcatgtacacaatcaagatgaaat
atggaggagagcaagtgcctaaattccctgcccgggtgaaagtggagccagctgtggaca
caagcagagttaaagtgtttgggccaggagtggaagggaaagatgtcttccgagaagcta
caacggagttcactgtggatgcccgacctctaacgaaagctggtggtgaccacatcagga
cacagatcacaagcccatccggctcccccacagactgtcagatccaagacaatgctgatg
ggacgtacgcagtggagtacacgccatttgaaaagggtccacacacagtcagtgtaacat
atgatggcgtgcctgtgccaaacagtcccttcagagtgaatgtgacggagggctgccatc
catcacgtgttaaggcacaaggacctggactcaaagaagctttcacaaatcagccaaatg
ccttttcagttgtcaccagaggggcaggaattggtggccttggaataactgttgagggac
cttcagagtctaaaatcagctgtaaagacaacaaggatgggagctgcagtgctgagtacg
ttccttatgttccaggagactacgatgtcaatattacgtacgggggagaacatattcctg
gcagtcctttcaaggttcctgtgaaggatgttgtggatcccagcaaggtgaagattgcag
gaccaggcctgggaacagctgttcgagccaaaatcccgcagtcctttactgtggacacca
gcaaggcaggagcggcacccctggaggtggtggtggcaggacccagagtggatgagacgg
attcccagggatggcgctctccattgaaaaacatttcggattttcttaagggtgatccaa
agggtgaggctgcgacaggaattgtggagcctgttaatgtagtagacaacggagatggca
cccacacagtggtgtacacccctacacaggagggaccatacatgatctctgtcaaatatg
cagacgaagagattcctcgcagccccttcaaggtgaaggtgcttcctacatatgatgcca
gtaaagtgacagcaagtggaccaggtctcagttcctatggcataccagccagtctgcctg
tggagtttgctgtagatgctaaagatgccgggcagggacttctcactgtgcagataactg
accaagagggtaagcccaagagagtggacattcatgacaacaaggatggcacatacacag
tgacctacgtccctgacaaaacgggccgctatacgattggtgtgaagtacggtggggatg
acatcccatcctctccctaccgaatccgggcgtctccagcgggggatgccagcaagtgtt
tggccacaggtcctggaattgcacccacagtgaggactggtgaggaggttggttttgtgg
tggatgccaaatcagcagggaaaggaaaagtgacgtgcaccgtcctgacaccagatggga
cagaagctgaggcagatgttgttgaaaacgaggacgggacttatgatatcttctacacag
ctgccaaaccaggaacctacgtgatttacgtccgcttcggtggggtagacattcccaaca
gtcctttcactgtgatggctgtagatgcagatgatgctgctgtgcggtcgcaggagacag
tgggtgcatccccacccggattccgcccttgggtcacagaagaggcttatgtaccagttg
gcgacatgaacggcatgggattccggcccttcgatatggttatcccctttgctgtaagga
aaggagaaataacaggtgaagtacacatgccctccggaaagactgatacaccagacattg
tggataacaaggatggtactgtaacagtgagatacgctcctacagaagtggggctgcatg
agatgcacataaaatacatgggaaatcacatcccagagagccctctacagttctatgtga
attatccaaacagcggcagcgtgtctgcttatgggcctggcctcatttatggggttgcta
ataaaccagcgacctttaccattgtcacggaagatgcagaggagggtggactggacttgg
ctattgaaggaccttccaaagcggagatcagctgcattgataacaaagatgggacgtgca
cagtcacctacctgcccactctacctgggaactacagcatactggtcaagtacaatgaca
agcacatccctggcagcccattcacagccaagattacagatgataacagaagacggtccc
aagttaagcttggatctgctgctgagtttttgttggatatcaacgagactgatctcagtc
tcctgacagctagcattaaagccccatcaggtcgtgatgaaccttgtcttctgaagaggc
tgcccaacaaccacattggtatctcattcatcccacgggaagtaggagaacatctggtta
gcatcaagaaaaatgggaaccatgtaccaaacagccctgtaacaatcatggtggtccagt
ctgagataggagatgccagacgagcaagagtttatggacgtggattggtagaagggcgaa
cctttgaaatgtgtgactttattgtagacacaagagatgcaggttatggtgggatctcgc
tggcagttgaaggacccagcaaggtagatatccaaactgaagacctagaagatggaactt
gcaaagtatcctattttccaactgtacctggcgtgtacattgtgtccactaaatttgcag
atgaacatattccaggcagcccatttactgtgaagataagtggtgagggaagagttaagg
agagcatcacacgaacaagacgggctccctctgttgcaacagttggaagcatatgtgatc
tgaacctaaaaatcccagaaattgactgtggggacatgacagcccaggtaactagtccct
ctggaagaaactccgatgcagaaatagtagaagttgacaaaaacacctactgtgtccgct
ttgtgccacaagaaatgggggtccacacagtagatgtcaaatacagagggcagcccgtgc
caggcagccccttccagttcactgtggggccactcggcgaaggaggagcccataaagtga
gagctggaggcccagggctggaacgtggagagacaggtgtcccagctgagttcagcatat
ggacacgggaggctggagctggaggactgtccattgctgtagaaggtccaagtaaagcag
aaattgcctttgaagaccataaagatggatcttgtggtgtatcttacatagttcaagagc
caggcaactatgaggtgtccataaagttcaacgatgagcacattcctgaaagcccctacc
tggttcccatcatcgccccgtctgatgatgctcgcaggctcactgtcactagccttcagg
agtctggattaaaagttaatcagccggcatcctttgctataaggctgaacggggcaaagg
gcaagattgatgctaaagtccacagcccctccggagctgtagaagagtgccatgtgtctg
agctggagccagacaaatatgccgttcggtttatcccccacgaaaatggcatccactcca
tcgatgtgaagttcaacgggagccacgtggtgggcagccccttcaaggtgcgtgttggtg
agcccggccaggcgggcaaccccacgctcgtcacagcgtatggaccaggcctggagagcg
gcaccacgggattgcagtcggagtttttcattaacacgaccaaggctggtccaggtaccc
tctctgttacaattgaagggccatcaaaggtgaaaatggactgccaggaaactccagaag
gttacaaagtcatgtacacacccatggctccgggaaactatttaattggagttaaatatg
gtggacctaaccacatagtgggcagccccttcaaggcaaaggttacaggacagcggctgg
tcaccctgggcagcgcaaacgaaacctcttccatcatggtggagtcggtgacgaggtcat
cgaccgaaacttgctatagtgccattcccaaatccacctcggatgccagcaaagtggttt
cccggggagcaggactctcaaaggcttttgtgggtcagaaaagctccttctctgtggact
gcagcaaagcaggttcaaatatgctgttagttggcgtccacggacctacaatcccatgtg
aagaggtttccatcaagcatctgggcaaccaccagtacaacgtgacgtatgtggtcaagg
agaggggtgactacgtcctggcagtgaagtggggtgatgagcacatccctgggagcccct
tccatgtcacggttccctaa

DBGET integrated database retrieval system