KEGG   Meleagris gallopavo (turkey): 100549150Help
Entry
100549150         CDS       T01523                                 

Definition
calcineurin subunit B type 1-like
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Oocyte meiosis
Apoptosis
Wnt signaling pathway
VEGF signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100549150
   04310 Wnt signaling pathway
    100549150
   04370 VEGF signaling pathway
    100549150
   04020 Calcium signaling pathway
    100549150
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100549150
   04210 Apoptosis
    100549150
Protein phosphatases and associated proteins [BR:mgp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100549150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 195 aa AA seqDB search
MDLPFPGKVSHYCEPNIKHLKDNINTGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNS
GSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFA
FRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCA
VVGGLDIHKKMVVDV
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggatttgcctttccctggcaaagtatctcactattgtgagccaaatatcaaacacctg
aaagacaacatcaacacgggaaatgaggcaagctaccctttggaaatgtgctcgcacttt
gatgctgatgagattaaacggttaggaaagagatttaagaagcttgatttggacaactct
ggttctttgagtgtggaagagttcatgtctttacctgaattgcaacagaacccgttggta
cagcgagtaatagatatatttgacacagacggcaatggagaagtggacttcaaagaattt
atagaaggagtctcccagttcagtgtcaaaggagataaggaacagaaattgaggtttgct
tttcgcatctacgatatggacaaagatggttatatctcaaatggtgagctcttccaggtg
ctgaagatgatggtggggaacaatctcaaagacactcagttacagcaaattgtagataaa
accataattaatgcagataaagatggtgatggaagaatatcctttgaagaattctgtgct
gttgtaggaggcctagatatccacaaaaagatggtggtagatgtgtga

DBGET integrated database retrieval system