KEGG   Meleagris gallopavo (turkey): 100549150Help
Entry
100549150         CDS       T01523                                 

Gene name
PPP3R1
Definition
(RefSeq) protein phosphatase 3 regulatory subunit B, alpha
  KO
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Oocyte meiosis
Cellular senescence
Wnt signaling pathway
VEGF signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100549150 (PPP3R1)
   04310 Wnt signaling pathway
    100549150 (PPP3R1)
   04370 VEGF signaling pathway
    100549150 (PPP3R1)
   04020 Calcium signaling pathway
    100549150 (PPP3R1)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100549150 (PPP3R1)
   04218 Cellular senescence
    100549150 (PPP3R1)
Protein phosphatases and associated proteins [BR:mgp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100549150 (PPP3R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
2
AA seq 184 aa AA seqDB search
MPMSVLADCKELDFCGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSL
PELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGY
ISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKM
VVDV
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgagtgtattagcagactgtaaagaattggatttttgtggaaatgaggcaagc
taccctttggaaatgtgctcgcactttgatgctgatgagattaaacggttaggaaagaga
tttaagaagcttgatttggacaactctggttctttgagtgtggaagagttcatgtcttta
cctgaattgcaacagaacccgttggtacagcgagtaatagatatatttgacacagacggc
aatggagaagtggacttcaaagaatttatagaaggagtctcccagttcagtgtcaaagga
gataaggaacagaaattgaggtttgcttttcgcatctacgatatggacaaagatggttat
atctcaaatggtgagctcttccaggtgctgaagatgatggtggggaacaatctcaaagac
actcagttacagcaaattgtagataaaaccataattaatgcagataaagatggtgatgga
agaatatcctttgaagaattctgtgctgttgtaggaggcctagatatccacaaaaagatg
gtggtagatgtgtga

DBGET integrated database retrieval system