KEGG   Meleagris gallopavo (turkey): 100549150Help
Entry
100549150         CDS       T01523                                 

Gene name
PPP3R1
Definition
(RefSeq) protein phosphatase 3 regulatory subunit B, alpha
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04010  MAPK signaling pathway
mgp04020  Calcium signaling pathway
mgp04114  Oocyte meiosis
mgp04218  Cellular senescence
mgp04310  Wnt signaling pathway
mgp04370  VEGF signaling pathway
mgp04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100549150 (PPP3R1)
   04310 Wnt signaling pathway
    100549150 (PPP3R1)
   04370 VEGF signaling pathway
    100549150 (PPP3R1)
   04020 Calcium signaling pathway
    100549150 (PPP3R1)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100549150 (PPP3R1)
   04218 Cellular senescence
    100549150 (PPP3R1)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    100549150 (PPP3R1)
Protein phosphatases and associated proteins [BR:mgp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100549150 (PPP3R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Motif
Other DBs
NCBI-GeneID: 100549150
NCBI-ProteinID: XP_010704741
Ensembl: ENSMGAG00000004474
Position
2
AA seq 184 aa AA seqDB search
MPMSVLADCKELDFCGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSL
PELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGY
ISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKM
VVDV
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgagtgtattagcagactgtaaagaattggatttttgtggaaatgaggcaagc
taccctttggaaatgtgctcgcactttgatgctgatgagattaaacggttaggaaagaga
tttaagaagcttgatttggacaactctggttctttgagtgtggaagagttcatgtcttta
cctgaattgcaacagaacccgttggtacagcgagtaatagatatatttgacacagacggc
aatggagaagtggacttcaaagaatttatagaaggagtctcccagttcagtgtcaaagga
gataaggaacagaaattgaggtttgcttttcgcatctacgatatggacaaagatggttat
atctcaaatggtgagctcttccaggtgctgaagatgatggtggggaacaatctcaaagac
actcagttacagcaaattgtagataaaaccataattaatgcagataaagatggtgatgga
agaatatcctttgaagaattctgtgctgttgtaggaggcctagatatccacaaaaagatg
gtggtagatgtgtga

DBGET integrated database retrieval system