KEGG   Meleagris gallopavo (turkey): 100549190Help
Entry
100549190         CDS       T01523                                 

Gene name
PTPRR
Definition
protein tyrosine phosphatase, receptor type, R
Orthology
K04458  
receptor-type tyrosine-protein phosphatase R [EC:3.1.3.48]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100549190 (PTPRR)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100549190 (PTPRR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 665 aa AA seqDB search
MKIMFLLAKESGADSDSCPSHHSIANARCFSGDNDHFLTIHQRKSGKPVFIYHHVQSLEK
SLDTDSYKNSKQHFHSSSHTKINKLHPAIVVKSTFPRPAYDPSLNLLAMTGQDLEVENLP
IPATNVIVVTLQMDINKLNITLLRIFRQGVAAALGLLPQQVHINRLIGKKNCVELFVSPL
NRKPGISDALPSEEVLRSLNINILHQSLSQFGITEVSPEKNVLQGQREADKIWSKEGFYA
VVIFLSIFVILVTCLMVLYRLKEKIQLSLRQEKEKKQEIHLSPLPLQTSRSEYKTTNSMV
QPEQAPKVVNVVVDPQGQCVPELKPPPCASPSPFRMKSVGLQERRGSNVSLTLDMSSLGS
IEPFVAVPTPREKVAMEYLQSAGRVLTRQQLRDAVACSHLLQTEFMEIPMNFVDPKEIDI
PSHGTKNRYKTILPNPLSRVYLKPKNPSDSLSTYINANYIRGYGGKEKAFIATQGPMINT
VNDFWQMVWQEDSPVIVMITKLKEKNEKCVLYWPEKRGIYGKVEVLVNSVQECENYTVRQ
LTIKQGSQSRSVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLEAPARGPIVVHCSAGI
GRTGCFIATAIGCQQLKEEGVVDALSIVCQLRVDRGGMVQTSEQYEFVHHALSLYESRLS
AEAVQ
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcatgttcctcctggcaaaggaatcaggtgctgacagcgacagctgtcccagt
catcactccattgccaatgccagatgcttttctggagacaatgaccacttcttgacaatt
catcagagaaagagtggaaaacctgtattcatttatcaccatgtgcagagtctggaaaaa
agtctggatacagacagttataagaattccaaacaacatttccattcttcttcccatacc
aaaataaacaagctgcaccctgcaatagttgttaaatcaacgttccccagacctgcctac
gacccatctctcaatctgttagctatgacaggtcaagacttggaagtggaaaatcttccc
attcctgcgacgaatgtgattgttgtgacactgcaaatggacataaacaagctgaatatc
acgttgcttcggatatttcgccaaggagtggctgcagcactgggactgttaccccagcaa
gttcacatcaacagactcattggcaagaagaactgtgtggaactgtttgtgtctcccttg
aacagaaagccaggaatttctgatgcactcccatcagaagaagttctgcgttcacttaat
atcaacattttgcatcagagtttatcgcagtttggaataacagaggtctcccctgagaaa
aatgttttgcaaggccagcgggaagcagacaaaatctggagcaaagaaggattttacgcg
gttgtcatatttctcagcatctttgtcattctagtaacttgtttaatggttctgtataga
ttaaaggagaagatccagttgtcgctgagacaagagaaggaaaagaagcaagagatccat
ctctcaccacttcccctgcagacatctcgatctgaatataagactaccaacagcatggtc
cagcctgaacaggctccaaaggttgtcaatgtggtagtggaccctcaaggccaatgtgtt
cctgagctcaaacctcccccgtgtgccagtccgtctcctttcagaatgaaatctgtggga
ctccaggaaaggcgaggatccaatgtctctctaactttggacatgagtagtttgggaagt
attgagcctttcgttgctgtgccaactccgcgagaaaaagtggccatggaatacctacag
tcagctggtcgcgtcctgacaaggcagcagcttcgagatgcagttgcatgttctcattta
cttcaaacagaattcatggaaataccaatgaattttgtggatcccaaagaaattgacatc
ccgagtcatggaactaaaaaccgctataaaacaattttgccaaatcctctaagcagagtg
tatttgaaaccaaaaaatccatctgactccttgagtacctacataaatgctaactacatt
aggggatatggaggtaaagagaaggcattcattgcaacacagggacccatgattaatact
gtgaatgacttctggcaaatggtttggcaagaggacagccctgtcattgttatgatcaca
aagctgaaagaaaaaaatgagaagtgtgtgctctattggccagaaaaaagaggaatctat
gggaaggttgaagtccttgttaacagtgtgcaagaatgtgagaactatactgtccgtcag
ctcacaataaagcaagggagtcagtctcggagtgtgaaacactactggtacacatcctgg
cctgaccacaaaacacccgacagcgcccagccactgctgcagctgatgctggatgtagag
gaggacaggctggaagcacctgcccgagggcccatcgtcgtgcactgcagtgctggtata
ggaagaactgggtgttttatcgccactgccattggttgtcagcagttgaaggaagaagga
gttgtagatgcactgagcattgtctgccagctacgagtggacagaggtggaatggttcag
accagtgaacagtatgaatttgtgcaccacgcactaagtctgtatgaaagccgactttct
gcagaagctgtccagtga

DBGET integrated database retrieval system