KEGG   Meleagris gallopavo (turkey): 100549220Help
Entry
100549220         CDS       T01523                                 

Definition
retinoic acid receptor RXR-gamma-like
Orthology
K08526  
retinoid X receptor gamma
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
PPAR signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    100549220
   03320 PPAR signaling pathway
    100549220
Transcription factors [BR:mgp03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    100549220
Nuclear receptors [BR:mgp03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   100549220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
10
AA seq 494 aa AA seqDB search
MYGNYPHFIKFPAGFGNSPVHASSTSVSPSSSLSVGSTVDGHPNYLEAPTNASRALPSPM
NTIGSPVNALGSPYRVIASSIGSHPVALSSSAPGMNFVTHSPQLNVLNNVSSSEDIKPLP
GLPGIGNMNYPSTSPGSLAKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCR
DNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRSRERSENEAESTSGGSEDMPV
ERILEAELAVEPKTEAYSDVNTESSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLE
DQVILLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVS
KMKDMQMDKSELGCLRAIVLFNPDAKGLSSPSEVESLREKVYATLEAYTKQKYPEHPKPR
GERGRRGPRLNNPGAVAEGVGLPPSIPEASLPEPPKVSGRTPDGSSAPSEPQTLAMVGRT
REEGSGKRGAPGLP
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtatgggaattatcctcacttcattaagtttcctgcgggttttggcaattcccctgtt
cacgccagctccacgtctgtgagcccatcatccagcctgtccgtggggagcacagtggac
ggacaccccaactacctcgaggcccccacaaacgcctcccgggcgctgccatcccccatg
aacaccatcggctctccagtgaacgcgttgggctcaccctacagggtcattgcatcctcc
attggctcgcatcccgttgctctgtcctcctcagccccgggcatgaactttgtgacccac
agcccacagctcaatgtactcaacaatgtcagcagctcggaggacatcaagcccttgcca
ggtcttccggggattgggaacatgaattatccatccacaagcccgggttccttagccaaa
cacatctgtgccatctgtggggacaggtcctcagggaagcactatggggtgtacagctgc
gagggctgcaagggcttctttaagaggaccatccggaaggacctgatctacacctgccgt
gacaacaaggactgcctcatcgacaagcgccaacgcaaccgctgccagtactgccgctat
cagaagtgcctcgccatggggatgaagagggaagctgtgcaggaggagaggcagcggagc
agggagcgcagtgagaatgaagctgagtccacgagcggtggcagtgaagacatgcctgtg
gagaggatcctggaagctgagctggcagtcgaacccaagactgaggcatacagtgatgtg
aacacagagagctcaacaaatgaccctgtcaccaacatctgccacgccgctgacaagcag
ctcttcactcttgttgagtgggccaagcgcatcccccacttctccgacctgaccctggag
gaccaagtcattctcctgcgggcaggctggaacgagctgctcatcgcatccttctcccat
cgctccgtgtcggtgcaggacggcatcctgctggccacaggcttgcatgtgcaccgcagc
agtgctcacagtgcaggcgtgggctccatctttgacagagttttgacagagctggtgtcc
aaaatgaaggacatgcagatggataagtcggagctggggtgtctgcgagccattgtcctc
ttcaacccagacgccaagggcctgtccagcccctcagaagtggagtcgctgcgggagaag
gtctacgccacgctggaagcctacacgaagcagaagtaccccgagcaccccaaacctcgg
ggagagcggggccgccgggggccgcggctgaacaaccccggggcggtggctgaaggcgtg
gggctgcccccctctatccccgaggcctccctaccggagccgcccaaggtaagcggccga
acccccgacggcagctccgcgccctcagaaccccaaacccttgcgatggtggggaggacg
cgggaggagggttcggggaagcgaggtgccccggggctgccgtag

DBGET integrated database retrieval system