KEGG   Meleagris gallopavo (turkey): 100549223Help
Entry
100549223         CDS       T01523                                 

Definition
eukaryotic translation initiation factor 3 subunit J-like
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100549223
Translation factors [BR:mgp03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100549223
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 244 aa AA seqDB search
MVAGLTHNVPTVCVTSVYTSLAKSNLLSLQVPLIQDNWDDEEEEEEVKETEVKQEPKVSE
KKKIAEKIKEKEKQQKKKQEELKKRLEAPEEHKELTPEEQLADKLRLKKLQEESDLELAK
ETFGVNNTCGIDAMNPSSKDDFTEFGKLLKEKITQYEKSLHYASFLEALVRDVCISLEID
DLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGEYVQEF
EDFM
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggttgcagggctcacccataatgtgcccacggtctgtgtgacttctgtgtataccagc
cttgccaaaagtaatctcttaagcttgcaggttccattgatacaggataactgggatgat
gaggaggaagaggaggaagtaaaggagacggaggtgaaacaagaacccaaagtttcagaa
aaaaagaaaatagcagaaaagataaaagaaaaagaaaagcaacagaagaaaaagcaagag
gagcttaaaaaaaggttagaggctccagaggaacataaagaacttacaccagaagaacag
ttagcagacaaactacgactaaagaaattgcaagaggagtcagaccttgagttagcaaaa
gaaacatttggtgtaaataacacttgtggaatagatgccatgaatccctcttcaaaagat
gactttacggaatttggcaaactactaaaagagaaaatcacacagtatgaaaagtcctta
cattacgccagctttttggaagcattagttcgagacgtttgtatttcattggaaattgat
gacttgaaaaagatcacaaattcgttgacggtactatgcagtgaaaaacagaaacaggag
aagcagagtaaagccaaaaagaagaaaaaaggtgttgtgcctggaggtggtttaaaggct
actatgaaagatgacctggctgattatggaggatacgatggagaatacgtacaagaattt
gaagacttcatgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system