KEGG   Meleagris gallopavo (turkey): 100549225Help
Entry
100549225         CDS       T01523                                 

Gene name
BCO1
Definition
(RefSeq) beta-carotene oxygenase 1
  KO
K00515  
beta-carotene 15,15'-dioxygenase [EC:1.13.11.63]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100549225 (BCO1)
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.63  beta-carotene 15,15'-dioxygenase
     100549225 (BCO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
13
AA seq 526 aa AA seqDB search
METIFSRNKVEHPEPIKAEVQGQLPTWLQGVLLRNGPGMHTIGDTKYNHWFDGLALLHSF
TFKNGEVYYRSKYLRSDTYNCNIETNRIVVSEFGTMAYPDPCKNIFAKAFSYLSHTIPEF
TDNCLINIMKSGDDYYATSETNFIRKIDPQTLETLEKVDYSKYVAVNLATSHPHYDSAGN
ILNMGTSIVDKGRTKYLLFKIPSSVPEKEKKKSCFKHTEVVCSIPSRSLLQPSYYHSFGI
TENYIVFIEQPFKLDIVKLATAYIRGVNWASCLAFHKEDKTWFHFVDRKTKKEVSTKFYT
DAMVLYHHMNAYEEDGHIVFDIVAYKDNSLYDMFYLKNLNKDFEENSKLTSIPACKRFVV
PLQYDKDAELGSNLVKLPTSATAVKEKDGSIYCQPEILCEGIELPRVNYDYNGKKYKYVY
AAEVQWSPVPTKIAKLNVQTKEMLHWGEEHCWPSEPIFVPSPGAREEDEGVVLTCVVVSE
PNKAPFLLILDAKTFKELGRATVNVEMHLDLHGMFIPQNDLEAEME
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggagacaatatttagcagaaacaaagtagaacatccagagcccataaaagctgaggtg
caaggtcagttgcccacttggttgcaaggagtacttctccgaaatggcccagggatgcat
acaataggggacactaaatacaaccactggttcgatggcttggctctgctgcacagcttc
acatttaaaaatggtgaagtttactacagaagtaagtacctccgaagtgacacgtacaac
tgcaatatagaaacaaaccgaatcgtggtgtctgagtttggaaccatggcttatccagat
ccatgcaaaaacatatttgccaaggcattctcatacttatctcacaccattcctgagttc
acggacaactgcttgatcaacattatgaagagtggggatgattattatgctaccagtgag
actaacttcatcagaaaaattgatccacagactctggagacactagaaaaggtagactac
agcaaatacgtagctgtaaacttggcaacttctcacccacactatgacagtgctggaaat
attctcaacatgggtacttcaattgttgataaagggagaacgaaatatcttctctttaag
atcccctcctctgtaccagagaaagaaaagaagaaatcttgttttaaacacacagaagta
gtatgctccatcccttctcgctccctgctccaaccaagttactaccacagctttggaatc
acagagaattatattgtgttcatagaacagccattcaagctggatattgtcaaactggca
actgcctacatccgaggtgtgaactgggcttcctgccttgcctttcataaggaggataag
acgtggtttcactttgtagacagaaagacaaaaaaagaagtatccaccaagttttacact
gatgctatggtgctttatcaccacatgaatgcttatgaagaagacggccacattgttttt
gatatcgttgcctacaaagacaatagcttgtatgatatgttttacttaaaaaacctgaac
aaagactttgaagagaacagcaagcttacctccatcccagcctgcaagcggtttgttgtg
cctctgcagtatgacaaggatgcagaattaggttctaatttagtcaaacttccaacttcc
gcaactgctgtaaaagaaaaagatggcagcatctattgccaacctgaaatattatgtgaa
gggatagagctgcctcgtgtcaactatgactacaatggcaaaaaatacaaatatgtctat
gcagcagaagtccagtggagtccagttcctacaaagattgcaaaactgaacgtccaaaca
aaggaaatgctgcactggggagaagagcactgctggccctcagagcccatcttcgttccc
agccccggcgcaagagaagaggatgaaggtgttgttttgacctgtgttgtggtgtctgag
ccaaacaaagcacccttcctactcatcttggatgctaaaacattcaaagaattgggccga
gccactgttaatgtggaaatgcatctggacctgcatggaatgtttataccacagaatgat
ttggaggctgagatggagtaa

DBGET integrated database retrieval system