KEGG   Meleagris gallopavo (turkey): 100549268Help
Entry
100549268         CDS       T01523                                 

Definition
(RefSeq) aldehyde oxidase 2-like
  KO
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100549268
   00350 Tyrosine metabolism
    100549268
   00380 Tryptophan metabolism
    100549268
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    100549268
   00760 Nicotinate and nicotinamide metabolism
    100549268
   00830 Retinol metabolism
    100549268
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    100549268
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     100549268
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 1361 aa AA seqDB search
MACHDKQPDDLIFFVNGKKVIERQADPEELLLYYLRKELRLSGTKYGCGVGGCGACTVML
STYDPVAKKIRHHPANSCLLPICSLHGAAVTTVEGVGSIKKRINPIQERLAKCHGSQCGF
CTPGMVMSIYALVRNHVKPSMEQIISALDGNLCRCTGYRPIIDSYASFAKEQTCCQLRGT
GQCCLDQEELGCSSSAGVRIRSGLCNPAEFLPVDPTQEFIFPPELMRMAQEQQKKTLTFC
SKRTTWISPSSLKELLELKAKYPKAPLVVGNTSLGLNKNDHDAYHPIILHPLRIPEMQVV
SITDDGIVIGAACCLAQLRDILMETIPKLPNEKTKIYQALLQQLRTLAGEQIRSMASLGG
HIVSRGSAWDLNPILSAGKSVLSLASNGGKRQIFLNDQFLAGHKHADIEPKEVIVSVLIP
YSTKDEFISAFRQADRQKNAFSVVNAGLRVLFSPGTDTIVDLSILYGGIGSTTLSARKSC
EKLIGRQWDDQMLSEACKLVLEEISLPPSASGGKVEYRRTLLVSFLFRFYLEVLHGLHQM
VRTGQELHISISREAARNFWYAELSQDKMSALGMLQSGVPQGVQVYQDVDRGQSPQDPVG
RPIMHQSGIKHTTGEAVYIDDIRPVDGELSLAVVTSIKAHAKIKSIDISEALQVPGVINV
VTAKDVPGKNGNDEEEAFAKDKVICVGQIICAVVAETLTQAKCGAKKVKIVYEDLQPVLA
IKVTMHLLFLDAIKHNSYITEERKLEKGDIEKGFKSADKIIEGELHMGGQEHFYLETNSV
VVIPRMEDKEMDVYVSTQHATEVQKLVASALNLQSNKVMCHTKRVGGAFGGKITKPSFFA
VIAAVAANKTGRPVRFALERDMDMLITGGRHPFFGKYKVGFMKNGRIMAADFQCYINGGC
TKDESELVIEYIVLKVDNAYNIPNLRVRGHACKTNLPSNTAFRGFGFPQAGLFVETCIVA
VATKTGLPHEKVREINMYKGVNRTAFEEEFDAENLWKCWKECLVKSDYHSRNAKVEEFNK
KNYWKKKGIAIISMKFSVGFNATYFHQAGALVHIYLDGSVLVTHGGIELGQGIHTKMLQI
ASHELKIPLSYIHFCETSSTTVPNGKYTAGSVGTEINARAVQDACQILWKRLDPIRRKNP
KGKWEDWISEAHKKSISLSATGYFKGYETNMNWETKKGHAFPYFLYGAACSEVEIDCLTG
AHKNIRTDIVMDASFSINPAIDIGQIEGAFIQGVGLYTLEEIYFSPEGEQLTLSPDTYKI
PAVCDIPEQFHVYLLPNSCNSIAIYSSKGVGEAGFFLGSSVFFAIRDAVAAVRKERGLPL
DFTLNSPLTVERIRMACDDIFTKMIPKDKPGTYKPWAIDIS
NT seq 4086 nt NT seq  +upstreamnt  +downstreamnt
atggcttgccatgacaaacaaccagatgaccttatcttttttgtgaatggcaagaaggta
attgagaggcaggcagatcctgaagaattactcctgtattatctaagaaaggaactccgt
ctctcaggaacaaagtatggctgtggagtaggaggctgtggtgcatgcactgtgatgtta
tctacatatgacccagttgccaagaagatacgacaccatcccgccaactcctgcctgctc
cccatatgctcactgcatggtgctgccgttactactgtggaaggggttggaagcataaaa
aagaggattaatccaattcaggaaagacttgccaaatgccatggctcccagtgtggcttc
tgcacccctggaatggtgatgtccatatatgctttagtaagaaaccatgtgaaaccttcc
atggaacagataatttctgctctggatggtaatttatgccgttgcacaggatataggcca
attatagacagctatgcatcttttgctaaggagcaaacatgctgccagctgagaggaact
ggacaatgttgcttggatcaagaagaacttggatgctcatcttctgcaggagttcggatt
cgctcaggtctttgcaacccagcagaattcctacctgtggatccaacacaagaatttata
tttcctcctgaactaatgagaatggctcaagaacagcaaaaaaagactcttactttctgc
agtaagagaacaacatggatttctccctctagcctgaaggagcttctggagctgaaagcc
aagtatccaaaggcacctctcgttgtggggaacaccagcttaggactcaacaaaaatgac
catgatgcctatcatccaatcattctccatcctttgaggattccagaaatgcaagttgtg
agtatcacagatgatgggatagtaataggagctgcctgttgccttgcccagctcagagat
attctcatggagactatcccaaaactcccaaatgagaaaacaaaaatctaccaagctctc
ttgcagcagctgagaactctagctggagaacagatcaggagcatggcgtctttaggagga
cacattgtaagcaggggatcagcttgggacttgaacccaatcttatctgctggcaaatct
gttctcagcttggcatcaaatggtggcaaacgacagatttttttaaatgaccagtttctt
gctggccataagcacgcagacatagaacccaaggaggtcattgtttctgttcttatccca
tattctacaaaggatgaatttatttcagccttcagacaagctgaccgtcagaaaaatgct
ttttctgtggtgaatgctggattgcgagtcctcttcagtccaggcacagacacaattgta
gatctgagtattttatatggaggcattggctcaaccacactcagcgcaagaaagtcttgt
gagaagctcattggaagacagtgggatgatcagatgctgagtgaagcttgcaaactggtg
ctggaggaaatttctcttcctccatcagcttcaggtggaaaagtagagtatagaagaact
ctgcttgtcagcttcttattcagattttacctggaagtgttacatggcttacatcagatg
gtaaggactggacaagaactgcatatcagcattagcagagaggctgcaagaaatttctgg
tatgctgaactctcgcaggataagatgagtgctttgggaatgctacaaagtggtgttccc
cagggtgtccaagtctatcaggatgttgaccgaggacagtctccacaagaccccgtggga
cgtcccatcatgcaccagtctggtattaagcacaccactggtgaagcggtttacattgat
gacattcgtccagtggatggagaactttcattggctgtggttactagcattaaagcccat
gcaaagattaaatcaattgacatttcagaagcccttcaggtgccaggggtaattaatgtg
gtaacagcaaaagatgttccagggaaaaatggaaatgatgaagaggaagcatttgcaaaa
gacaaggtcatttgtgttggacagataatctgtgccgtggttgcagagacactgacacag
gcaaagtgtggagctaaaaaggtgaagatagtgtatgaagatctgcagccagtcctcgcc
attaaggtaacaatgcatctcctcttccttgatgcaataaaacataattcatacattact
gaagaaagaaaactagaaaaaggggacattgagaaaggatttaagtctgctgataaaatc
atagaaggtgaattgcacatgggaggacaggaacatttctacctggaaacaaatagtgtg
gttgttattccaagaatggaagataaagaaatggatgtgtatgtatcaactcagcatgca
acagaggtacagaaattagtggcttcagctttaaaccttcagtccaacaaggttatgtgt
cacacaaaacgtgttggtggagcatttggtgggaagataactaagccttcattctttgct
gtaattgcagcagtggcagccaacaagaccgggcgcccagtccgctttgcccttgaaaga
gacatggacatgttaatcactggtggacgtcatcctttctttggaaaatataaagtcgga
ttcatgaagaatggtagaataatggccgcggattttcaatgctatataaatggtggctgt
acaaaagatgaatctgagttggtgattgagtatattgtgctgaaagtggacaatgcatat
aatatccctaatctccgagtcaggggccatgcctgcaagactaatttgccttctaatact
gcctttcgaggatttgggtttcctcaggcaggtctgtttgtggagacctgtattgtggct
gtggcaaccaagactggactaccacatgagaaggttagggaaataaacatgtacaaagga
gttaaccgaacagccttcgaagaagaatttgatgcagagaatctgtggaaatgttggaaa
gaatgtttggttaagtctgactaccacagccggaacgcaaaggtggaagagtttaacaag
aagaattactggaaaaagaaagggattgccatcatttccatgaaattttctgttggattt
aatgcaacctattttcatcaggctggtgctcttgtccatatctacttagatgggtctgta
ctagtcactcatggtggcattgaacttggacagggaattcatactaagatgttacagatt
gccagccatgaactgaagataccactgtcatatatacacttctgtgaaacaagctcaaca
actgtacctaatggcaaatacacagcgggatcagttgggacagaaatcaatgcaagagca
gtacaggatgcttgtcaaatcctttggaagcgtctggaccctatcagaagaaagaatcct
aaaggcaaatgggaagactggatcagtgaagctcacaagaagagcatcagcctttcagcg
actggctatttcaaaggatatgagacaaacatgaactgggaaacaaagaaaggccatgca
ttcccatattttctctatggagctgcctgttctgaagtagaaattgactgccttacagga
gcacacaagaacattaggacagacattgtgatggatgcctcttttagcataaatccagct
atagatataggacagattgaaggggccttcattcagggggttggtctttacacattagaa
gaaatctacttttccccagaaggagagcagctcactcttagcccagatacatacaagatc
cctgcggtttgtgacattcctgagcaattccatgtctatttactgccaaattcatgcaac
tcaattgctatctattcttccaagggcgtgggtgaggctggattcttcctgggcagttca
gtgttttttgcaatacgtgatgcagtggctgctgtacggaaagaaagagggctacctctg
gacttcacactgaacagccccttgaccgttgagcggattcgtatggcctgtgatgatatc
tttactaagatgattccgaaagataaacctggaacctataagccatgggccattgatata
tcctaa

DBGET integrated database retrieval system