KEGG   Meleagris gallopavo (turkey): 100549276Help
Entry
100549276         CDS       T01523                                 

Definition
tropomyosin alpha-1 chain-like
Orthology
K10373  
tropomyosin 1
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Class
Organismal Systems; Circulatory system; Cardiac muscle contraction [PATH:mgp04260]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:mgp04261]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
12
AA seq 284 aa AA seqDB search
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEERSKQLEDELVALQKKLKGTEDELDKY
SESLKDAQEKLELADKKATDAESEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIENRAQKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERAE
ERAELSESKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE
FAERSVTKLEKSIDDLEEKVAHAKEENLNMHQMLDQTLLELNNM
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggatgccatcaagaaaaagatgcagatgctgaaactggacaaggagaatgccttggac
agagccgagcaagccgaagcggacaagaaggcagcggaggagaggagcaagcagctggag
gacgagctggtggctctgcaaaagaagctgaagggcactgaggatgagctggacaaatac
tccgagtcccttaaagatgcacaggaaaagttggaactggctgacaaaaaggccacagat
gctgagagtgaagtagcttccctgaacagacgcatccagctggttgaggaagagttggat
cgggctcaggagcgcttggctactgccctgcagaagctggaagaggctgagaaggctgca
gatgagagtgaaagaggaatgaaggtcattgaaaatagagcccagaaggatgaagagaag
atggaaatccaagagatccagcttaaagaagctaagcacattgctgaagaggccgaccgc
aagtatgaagaggtggctcgtaagcttgtgatcattgagggtgacctggagcgggctgag
gaacgtgctgaactatcggaaagcaaatgtgctgagcttgaagaggagttgaaaactgtg
accaacaacctgaagtcgctggaggctcaggctgagaagtactcacagaaagaagacaaa
tatgaagaggagattaaagttctaactgacaaactgaaggaggctgagacccgtgctgaa
tttgctgagaggtcagtaaccaagctggagaagagcattgatgatctagaagagaaagtg
gcgcatgccaaagaagaaaaccttaatatgcatcagatgctggatcaaactttactggag
ttaaacaacatgtga

DBGET integrated database retrieval system