KEGG   Meleagris gallopavo (turkey): 100549276Help
Entry
100549276         CDS       T01523                                 

Gene name
TPM1
Definition
(RefSeq) tropomyosin 1 (alpha)
  KO
K10373  
tropomyosin 1
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    100549276 (TPM1)
   04261 Adrenergic signaling in cardiomyocytes
    100549276 (TPM1)
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100549276 (TPM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
12
AA seq 260 aa AA seqDB search
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEERSKQLEDDIVQLEKQLRVTEDSRDQV
LEELHKSEDSLLSAEENAAKVSCPYCKHRESNCLSFFLSLCLSVRPFFSVSSALALLPLH
DHIACCTFSCLPSPLHHLPPVSQLEDELVALQKKLKGTEDELDKYSESLKDAQEKLELAD
KKATDEPHTDPGEIFLIRKSMQTIWESPGMKARAVLPDSLPEKHDPPDQSQRCFPLLESS
VWELVGTGVGCSHPGVEKLA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggatgccatcaagaaaaagatgcagatgctgaaactggacaaggagaatgccttggac
agagccgagcaagccgaagcggacaagaaggcagcggaggagaggagcaagcagttagag
gatgacattgtgcaattggaaaagcaattgcgtgtgacggaggattcgagggaccaagtg
ctggaagagctgcacaagtctgaggacagcctcctctccgcagaggagaatgctgccaag
gtatcgtgcccttactgtaagcacagagaatctaactgtctctccttctttctctctctc
tgtctctctgtccgtccgttcttttctgtctcttctgcactcgcacttctccctttgcac
gatcacattgcctgctgcaccttttcctgcctgccctcccctctccaccaccttccgccc
gtgtcacagctggaggacgagctggtggctctgcaaaagaagctgaagggcactgaggat
gagctggacaaatactccgagtcccttaaagatgcacaggaaaagttggaactggctgac
aaaaaggccacagatgaaccgcatacagatccaggggagatattccttataaggaaaagt
atgcagactatttgggaatcgccggggatgaaggcgagagcagtgctaccagattccctg
cctgaaaagcacgatccccccgaccaatcccagcgctgtttccctttgctggagagcagc
gtttgggagctcgttgggacgggtgttgggtgcagtcaccccggggtggagaagctggct
tga

DBGET integrated database retrieval system