KEGG   Meleagris gallopavo (turkey): 100549310Help
Entry
100549310         CDS       T01523                                 

Gene name
LYPLA1
Definition
lysophospholipase I
Orthology
K06128  
lysophospholipase I [EC:3.1.1.5]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100549310 (LYPLA1)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100549310 (LYPLA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 171 aa AA seqDB search
MPVTLNMNMAMPSWFDIIGLSPDSQEDEVGIKKAAENVKALIDQEVKNGIPSNRIILGGF
SQGGALSLYTALTTHQKLAGVVALSCWLPLRSSFVQGAVGVNKEIPVLQCHGDCDPLVPL
MFGSLTVEKLKSMINPANITFRTYSGMMHSSCIEEMMDIKQFIDKHLPPVD
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgccggttactttaaacatgaacatggctatgccatcatggtttgatatcattggactt
tctccagattcacaggaagatgaagttgggatcaagaaggcagcagagaatgttaaagca
ctgatagatcaagaagtaaaaaatggaattccttccaatcgaattattctgggaggcttt
tctcagggtggtgctttatcattgtatacagctcttacaacacatcagaagttagcaggt
gttgtagccctcagctgttggcttcctctacgttcctcttttgtacagggtgctgttggt
gtcaacaaggagattcctgttcttcagtgccatggggactgtgacccactcgttccttta
atgtttggttctcttactgttgagaagctaaagagtatgataaatccagccaatataacc
ttcagaacttactctggcatgatgcatagttcatgtattgaggagatgatggatataaaa
cagttcatagacaaacatctacctcccgtagactga

DBGET integrated database retrieval system