KEGG   Meleagris gallopavo (turkey): 100549310Help
Entry
100549310         CDS       T01523                                 

Gene name
LYPLA1
Definition
(RefSeq) lysophospholipase I
  KO
K06128  lysophospholipase I [EC:3.1.1.5]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100549310 (LYPLA1)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100549310 (LYPLA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_2 Hydrolase_4 Abhydrolase_3 Cutinase DUF2974 FSH1 Abhydrolase_1 DLH Abhydrolase_6 Esterase Lipase_3 PAF-AH_p_II DUF2920 AXE1
Motif
Other DBs
NCBI-GeneID: 100549310
NCBI-ProteinID: XP_010707234
Ensembl: ENSMGAG00000010920
Position
3
AA seq 171 aa AA seqDB search
MPVTLNMNMAMPSWFDIIGLSPDSQEDEVGIKKAAENVKALIDQEVKNGIPSNRIILGGF
SQGGALSLYTALTTHQKLAGVVALSCWLPLRSSFVQGAVGVNKEIPVLQCHGDCDPLVPL
MFGSLTVEKLKSMINPANITFRTYSGMMHSSCIEEMMDIKQFIDKHLPPVD
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgccggttactttaaacatgaacatggctatgccatcatggtttgatatcattggactt
tctccagattcacaggaagatgaagttgggatcaagaaggcagcagagaatgttaaagca
ctgatagatcaagaagtaaaaaatggaattccttccaatcgaattattctgggaggcttt
tctcagggtggtgctttatcattgtatacagctcttacaacacatcagaagttagcaggt
gttgtagccctcagctgttggcttcctctacgttcctcttttgtacagggtgctgttggt
gtcaacaaggagattcctgttcttcagtgccatggggactgtgacccactcgttccttta
atgtttggttctcttactgttgagaagctaaagagtatgataaatccagccaatataacc
ttcagaacttactctggcatgatgcatagttcatgtattgaggagatgatggatataaaa
cagttcatagacaaacatctacctcccgtagactga

DBGET integrated database retrieval system