KEGG   Meleagris gallopavo (turkey): 100549312Help
Entry
100549312         CDS       T01523                                 

Definition
UDP-glucuronosyltransferase 2C1-like
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100549312
   00053 Ascorbate and aldarate metabolism
    100549312
   00500 Starch and sucrose metabolism
    100549312
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100549312
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100549312
   00860 Porphyrin and chlorophyll metabolism
    100549312
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100549312
   00982 Drug metabolism - cytochrome P450
    100549312
   00983 Drug metabolism - other enzymes
    100549312
Enzymes [BR:mgp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100549312
Glycosyltransferases [BR:mgp01003]
 Others
  Hydrophobic molecule
   100549312
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 779 aa AA seqDB search
MSGKKVAVLWLLAVLGSVSGGKVLVWPVDNSHWLNMEFILRELVVRGHEVTVLLPSCFLI
LNGTEPLPFQFEMVEVPISKSEMAAAMDEGFYFWFYEERRLPFWESLKKMIDILRKFENI
TRTICDGIVKNKVLLERLRASGFDVLLADPLMPSGELFAEKLGIPLMYTIRFSMGNTVER
LCGGLPAPPSYVPASLSSLTDKMTYTQRIKNMLSYALQDLAYHYILWGHWNQYYSDILAC
SDWSCAWTAEMMGQRFSWLLWTFACCWSVGFCGKVVVWPSDASHWVNIKVLLEELILRGH
EVTVLVPSINLLIDYQDTSSPFTFEVLKVNITQETLDALMEDFLNLWINDLPNLFPWEVM
WRMKEAIYSFSNLSKQSCDALVSNPQLIAKLHQAKFDILVADPLAVCGELAADLLAIPFV
YSFRFSEGNVVERLCGGLPSPPSYVPASTTGLTDQMSFVERLQNFFFYFAMDLFFLKFWR
DEWDGYYSNVLGRPTTLCETMGKAEIWLIRTYWDFEFPRPFLPNFEFVGGLHCQPAKPLP
KEIEEFVQSSGEHGIVVFSLGSMVYNLTDERSNVIAKALSQLPQNVLWRYKGKKPEALGS
NTRIYDWIPQNDLLGHPLTKAFITHGGTNGIYEAIYHGVPMVGIPMFADQHDNIAHMRAK
GAAVELDFSTLTTQDLVDAVNTVINNSTYKESALKLSKIHHDQPIKPLDRAVFWIEFVMR
HKGAKHLRPAAHHLTWYQYHCLDVLAFLFTCAAIAGFILVKCCMFCCRKCGRVTKKKKE
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaaagaaggtggctgtgctgtggctgctggctgtgctgggctctgtgtctggt
gggaaggtgttggtctggccagttgacaacagccactggcttaacatggagtttatcctg
cgggaacttgtagtccggggccatgaggtgactgtgctgctgccttcgtgcttccttatc
ctcaatggcactgagcccttacctttccagtttgagatggtcgaggtaccaatcagcaaa
agtgagatggctgccgcaatggatgaaggtttctatttttggttctacgaggagagaagg
ttacccttctgggaaagtcttaaaaagatgattgatatactacgcaagttcgagaatata
accagaaccatttgcgatggaattgtgaagaacaaggtgctgctggaaaggctgagggca
tctggctttgatgtcctcctggcagacccactgatgcccagcggggagctgtttgcagaa
aagctgggtatccctttgatgtacaccatccggttctccatgggcaacacagtggagcgg
ctctgcgggggactcccagctcctccttcctatgtgccagccagcctaagctccctaaca
gacaagatgacctacacacagaggataaaaaacatgctctcctatgctctgcaggacctc
gcataccattacattctttggggacattggaatcaatactacagtgatattttagcatgc
tcagactggagttgtgcgtggactgctgagatgatggggcaaagattctcctggctactc
tggacctttgcgtgctgctggagtgttggcttttgtgggaaagtggtggtctggcccagc
gatgccagtcactgggtcaacattaaagtgttgctggaagagcttattctccggggtcat
gaagtgactgtgctggtaccatcaataaatctgctcatcgactaccaagacacgtcatct
cctttcacctttgaggtcctgaaagtgaacatcacccaagagaccctggatgctctcatg
gaggacttcctcaatctctggataaatgacctccctaatctgttcccctgggaggtcatg
tggaggatgaaagaagccatatactccttttccaacttgtcaaagcagtcctgtgatgcc
ttggtgtcaaatcctcagctgatagcaaagctgcatcaggccaagtttgatattctggta
gctgaccctctagctgtatgtggtgagcttgcagcagacctactggcaatcccttttgtc
tacagtttccgtttttctgaggggaacgtggtagagcggctgtgtggtgggctcccatct
ccaccttcttatgtgcctgctagcacaacagggttgacggaccagatgtcctttgtggag
agactgcagaatttcttcttttactttgccatggatttatttttcttaaagttttggcga
gatgaatgggacggatactacagtaatgtcttaggaaggcccacaaccctgtgtgagacg
atggggaaagcagagatatggctaatcagaacatactgggattttgaatttcctcgccct
ttcctgcccaactttgagtttgttggaggacttcattgccagcctgcaaagccactgcca
aaggaaattgaagaatttgttcagagttcaggggaacatggcattgtggtattttctctc
gggtcaatggtctacaacctaactgatgaaagaagtaatgtgattgccaaagcgctcagc
cagcttccacaaaatgtcctctggcgatacaaaggtaaaaaaccagaagctctgggctcc
aacaccaggatttatgactggataccccaaaatgacctgctcggccatcccttgacaaag
gccttcattactcatggtgggaccaatgggatctatgaagctatttaccatggagtccca
atggttgggattcccatgtttgctgaccagcatgacaacattgctcacatgagggcaaaa
ggagctgcagtggagctggatttcagcacactgacaacacaggatctagttgatgcagtg
aatacagtcattaacaattctacctacaaggaaagtgctttaaagttatccaagatacat
catgaccagccaattaagcctctggacagagctgtcttctggattgaatttgtcatgcgt
cacaaaggagcaaaacatttgagaccagctgctcaccatcttacctggtaccagtaccac
tgcctggatgttctggcattcttgttcacctgtgcagccattgctggcttcattcttgtc
aagtgctgcatgttttgctgtagaaaatgtggtagggtcacaaaaaaaaagaaagagtag

DBGET integrated database retrieval system