KEGG   Meleagris gallopavo (turkey): 100549320Help
Entry
100549320         CDS       T01523                                 

Gene name
PGAM1
Definition
(RefSeq) phosphoglycerate mutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00010  Glycolysis / Gluconeogenesis
mgp00260  Glycine, serine and threonine metabolism
mgp01100  Metabolic pathways
mgp01200  Carbon metabolism
mgp01230  Biosynthesis of amino acids
Module
mgp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mgp_M00002  Glycolysis, core module involving three-carbon compounds
mgp_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100549320 (PGAM1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100549320 (PGAM1)
Enzymes [BR:mgp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     100549320 (PGAM1)
Membrane trafficking [BR:mgp04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100549320 (PGAM1)
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100549320 (PGAM1)
  Exosomal proteins of melanoma cells
   100549320 (PGAM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 100549320
NCBI-ProteinID: XP_010713041
Position
8
AA seq 207 aa AA seqDB search
MQRMFDICFTSVQKRAIRTLWNVLDAIDQMWLPVVRTWRLNERHYGALTGLNKAETAAKH
GEAQVKIWRRSFDIPPPPMQSDHPFFSTISKDRRYADLTEDQLPTCESLKDTIARALPFW
NEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGMSEEAIMELNLPTGIPIVYELDKNLKPI
KPMQFLGDEETVRKAMEAVAAQGKVKK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgcagcggatgttcgatatctgcttcacgtcggtgcagaagagggccatccgcaccctc
tggaacgtgctggacgccatcgaccagatgtggctgcccgtggtgcggacgtggcgcctc
aacgagcggcactacggggccctcaccggcctcaacaaggctgagacagccgccaagcac
ggtgaggcccaggtgaagatctggaggcgctccttcgacatccccccgccgcccatgcag
tcggaccaccccttcttcagcaccatcagcaaggatcgtcgctatgctgacctgacagag
gaccagctgcccacatgtgagagcctgaaggacaccattgcccgggccctgcccttctgg
aatgaggaaattgtcccacagatcaaagagggcaagagagtccttattgcggcccatggc
aacagcctgagggggattgtcaagcacttggaaggcatgtcagaagaggctatcatggag
ctgaacctgcccaccggcatcccaattgtctatgaattggacaaaaacctcaagcccatc
aagcccatgcagttcctaggagatgaggagacggtgcgcaaggccatggaggctgtcgct
gctcagggcaaagtaaagaaatga

DBGET integrated database retrieval system