KEGG   Meleagris gallopavo (turkey): 100549349Help
Entry
100549349         CDS       T01523                                 

Definition
cysteinyl leukotriene receptor 2-like
Orthology
K04323  
cysteinyl leukotriene receptor 2
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100549349
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100549349
G protein-coupled receptors [BR:mgp04030]
 Class A. Rhodopsin family
  Other
   Cysteinyl leukotriene
    100549349
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 310 aa AA seqDB search
MNFSEKMLNNSSTNSSFNCHVDAFKQVIYPMTYLLIFFLGSVGNSLSIYVFLQPSQRKTS
VNIYMQNLAVSDLMFVSTLPFRATYYLLGSQWVFGDILCRIMTYTMYVNMYCSIYFLTVL
SVVRFTAIVYPFKSWKVTNMKYAKITCAVIWLFVLAASSPLLSKVIAGYQNPDKCLDLHP
SSTQNLLMMNSFVLVVGFILPFCTIIVCYIFAIRALLKSRTPQRKKAVCHKKALSTIIIT
LILFLLCFLPYHILRTVYLVLGGCSPANLFVHKAQVVSLCLAATNSCLDPVLYYFAAENF
KARIRSLYRR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaatttttctgagaagatgctaaataacagctccactaacagctcattcaactgtcat
gtggatgccttcaagcaagtcatttatcccatgacgtacctcttaatcttcttcctcggc
agtgttggaaatagcctctccatttatgttttcctccagccttcccagagaaagacctcg
gtaaacatttacatgcagaacttggcagtttcggatctcatgtttgtgagcactttgccc
ttccgagccacctattatctgttgggatcacagtgggtgtttggtgatatcctctgcagg
atcatgacgtacaccatgtatgtgaacatgtactgcagcatttattttctcactgtgctc
agtgtggttcgtttcacggctatcgtctacccattcaagagctggaaagtaaccaacatg
aagtatgccaagataacgtgcgcagtgatatggctctttgttctggctgcctccagccct
ctgctgagcaaagtaattgccgggtaccaaaacccagacaagtgcttggacctccacccc
agcagtacgcagaacctcctcatgatgaacagctttgtccttgttgtgggcttcatcttg
cctttttgcacaattatcgtctgctacatctttgccatcagagcgctgctcaagtccagg
actccccagcgcaagaaggcagtctgccacaagaaagcactgtcaaccatcattatcact
ctcatcctcttcctcctgtgcttcctgccgtaccacatactgaggacggtctacctggtg
cttggtggatgcagcccggccaatctgtttgtgcacaaagctcaggtggtctcgctctgc
cttgctgccaccaacagctgcctcgaccctgtgctatattacttcgctgctgaaaatttc
aaagcaagaatcagaagtttataccgaaggtag

DBGET integrated database retrieval system