KEGG   Meleagris gallopavo (turkey): 100549365Help
Entry
100549365         CDS       T01523                                 

Gene name
CYC
Definition
cytochrome c-like
Orthology
K08738  
cytochrome c
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Sulfur metabolism
p53 signaling pathway
Apoptosis
Influenza A
Herpes simplex infection
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:mgp00920]
Cellular Processes; Cell growth and death; Apoptosis [PATH:mgp04210]
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:mgp04115]
Human Diseases; Infectious diseases; Influenza A [PATH:mgp05164]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:mgp05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 105 aa AA seqDB search
MGDIEKGKKIFVQKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAEGFSYTDANKNKGITW
GEDTLMEYLENPKKYIPGTKMIFAGIKKKSERVDLIAYLKDATSK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggagatattgagaagggcaagaagatttttgtccagaaatgttcccagtgccataca
gttgaaaaaggaggcaagcataagactggacccaatctccatggcctgtttggacgcaaa
acagggcaagctgaaggtttctcttacacagatgctaataagaacaaaggtatcacttgg
ggtgaggatactctgatggagtatttggaaaatccaaagaagtacatcccaggaacaaag
atgattttcgcgggtatcaagaagaagtctgagagagtagacttaatagcatatctcaaa
gatgccacttcaaaataa

DBGET integrated database retrieval system