KEGG   Meleagris gallopavo (turkey): 100549365Help
Entry
100549365         CDS       T01523                                 

Gene name
CYC
Definition
cytochrome c-like
Orthology
K08738  
cytochrome c
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Sulfur metabolism
Metabolic pathways
p53 signaling pathway
Apoptosis
Influenza A
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    100549365 (CYC)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100549365 (CYC)
   04115 p53 signaling pathway
    100549365 (CYC)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    100549365 (CYC)
   05168 Herpes simplex infection
    100549365 (CYC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 105 aa AA seqDB search
MGDIEKGKKIFVQKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAEGFSYTDANKNKGITW
GEDTLMEYLENPKKYIPGTKMIFAGIKKKSERVDLIAYLKDATSK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggagatattgagaagggcaagaagatttttgtccagaaatgttcccagtgccataca
gttgaaaaaggaggcaagcataagactggacccaatctccatggcctgtttggacgcaaa
acagggcaagctgaaggtttctcttacacagatgctaataagaacaaaggtatcacttgg
ggtgaggatactctgatggagtatttggaaaatccaaagaagtacatcccaggaacaaag
atgattttcgcgggtatcaagaagaagtctgagagagtagacttaatagcatatctcaaa
gatgccacttcaaaataa

DBGET integrated database retrieval system