KEGG   Meleagris gallopavo (turkey): 100549387Help
Entry
100549387         CDS       T01523                                 

Definition
ubiquitin carboxyl-terminal hydrolase 48-like
Orthology
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.4.19.12]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100549387
Peptidases [BR:mgp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100549387
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
23
AA seq 1041 aa AA seqDB search
MAAESGPRRNPVFWGEVGCCQSLLLSPPPPPAPQTRGSVPSTGDGWSWCWSCRRNCRGNP
NCLVGIGEHVWLGEIDENSFHNIDDPNCERRKKNAFVGLTNLGATCYVNTFLQMWFLNLE
LRQALYLCSSNEHTVGESIPKDKDYEPQTICEHLQYLFALLQNSRRRYIDPSGFVKALGL
DTGQQQDAQEFSKLFMSLLEDTLSKXKNPDVRNIVQKQFCGEYAYVTVCNQCGRESKLVS
KFYELELNIQGHKQLTDCITEFLKEEKLEGDNRYFCETCQSKQNATRKIRLLSLPCTLNL
QLMRFVFDRQTGHKKKLNTYIGFSELLDMEPFMEQKNGVYVYELSAVLIHRGVSAYSGHY
IAHVKDPQTGEWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTRKPKCGKGTHCSRNAY
MLVYRLQTREKSLTVEVPAFLQELVERDNCKFEEWCNEMAEMRKQSVARGKIKHEEVKEL
YQRLPAEAGSPYDFISLEWLQKWLDESTPPKPIDNTACLCSHGKLHPDKICIMKRISEYV
ADFFYRRYGGGPRLNVKALCKDCVVERCRILRLKNQLNEDYKTVTNLLKITVKGSDGFWV
GKASLRSWRQLALEQLNEQDEDAEHSNGKLNGNAPNKDEVNEDKREEEEELNFNEDIVCP
HGDLCISENERRVVSKEAWKKLKQYFPKAPEFPSNKECCSQCKILEREGEENEALHKMMA
SEQKTSLQNLFHDKCRPCLGSWPQETDELYIVSQFFVEEWRKFVRRPTRCSPVSSLGNSA
LLCPHGGLMFTYASMTKEDSKLIALIWPSEWERIQKLFVVDHVIKITRTRAAGEPENALY
SSEPQLCPECREGLLCQQQRDLREYTQATIYIHKVVDNKKVMKDAAPELNVSSSEAEEER
EENKPEGEQDPDFNQSNGGAKRQKLSHQSYISYQKQGIRRSTRHRKVRGEKALLVSANQT
LKELKIQIMHAFSVAPFDQNLSINGKILSDDTATLGSLGVIPESVILLKADEPIADYAAM
DDVSPVCMPEEGFKGTGLLGH
NT seq 3126 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgaaagcggaccccgccggaaccccgtgttttggggagaggtgggatgctgc
cagtccctcttgctgtctccacctccccctccagccccccaaacgaggggctctgtccct
tccacgggtgacggatggtcctggtgctggtcctgcaggaggaactgccggggaaacccc
aactgtctggtgggcatcggggagcacgtctggctgggcgagatcgacgagaacagcttc
cacaacatcgatgatcccaactgtgagcgccgcaagaagaacgcatttgtgggcttaacg
aacctcggcgccacatgctacgtgaacacttttttgcagatgtggtttcttaatctggag
ctccggcaagccctctacttatgttccagcaatgagcacacagtcggagagagcatcccc
aaagataaagactatgagcctcagaccatttgtgagcatcttcagtacttgtttgccttg
ctgcagaacagcagaaggcgatacatcgatccctctggatttgtcaaagcgctgggcttg
gatacaggccagcagcaggatgcccaggaattttccaagctgttcatgtctctgctggaa
gatactttatccaaancaaaaaatccagacgttcgaaacattgttcagaaacagttctgt
ggggagtacgcctatgtcacagtctgcaaccagtgcggcagggagtccaaactcgtgtct
aagttttatgagctggagttaaacatccaagggcacaagcagctgacagactgcataaca
gagtttctcaaggaagaaaaattagaaggggacaatcgttatttttgcgaaacttgtcag
agtaagcagaatgccacaaggaagatcaggctgctaagtcttccatgcacactcaacctg
cagctgatgcgtttcgtgtttgacagacaaactggccataagaaaaagctgaacacctac
attggcttctctgagctgcttgacatggaaccttttatggaacaaaaaaatggtgtctat
gtgtacgaactgagtgctgttctcatacaccgaggtgtgagtgcgtactcagggcactac
atcgcccacgtgaaggacccacagacaggagagtggtacaaattcaatgacgaagacatt
gagaagatggaggggaagaaactgcagctggggattgaggaagatctagcagagccttcg
aagtctcagacccgtaaacctaaatgtgggaaagggacacactgctcacgcaatgcttac
atgctggtgtacaggctgcagacccgggagaagtcgctgacggtggaagtaccagctttc
ctgcaggagctggtggagcgtgacaactgcaagtttgaggagtggtgcaatgaaatggcc
gagatgcgcaaacagagcgtggccaggggcaaaatcaagcacgaagaggtgaaggagctc
taccaaaggttacctgctgaagctggttccccgtacgacttcatctctctggaatggctg
cagaagtggctggatgagtccacccctcccaaacccatagacaacacagcctgcctgtgc
tcgcacgggaagctgcatcctgacaagatatgcataatgaagaggatatctgagtacgtg
gctgacttcttctacaggagatacggcgggggacccaggctgaacgtcaaagcactttgc
aaggactgtgtggtagaaaggtgtcgaatcctgcgtctgaaaaaccagctgaacgaagac
tacaaaaccgtcaccaacttgctgaagataacagtcaaggggagtgacgggttttgggtt
ggaaaggcgtccttgcggagctggcgtcagttggctctggagcaattaaatgagcaagac
gaagacgcagagcacagcaatggaaaactgaatggaaatgcaccaaacaaagatgaagta
aatgaggacaagagagaggaggaagaagagttaaattttaatgaagacattgtttgccca
catggtgacctgtgcatatccgagaacgagaggagggtggtgtcaaaggaagcctggaag
aagctcaagcaatatttcccaaaggcccccgagttcccaagtaacaaagagtgctgttcc
cagtgcaagattttggagcgcgaaggagaagagaacgaagcactgcacaagatgatggcc
agtgagcagaagacatccctccagaacttgttccatgacaaatgccggccttgcctgggc
agctggccgcaggagacagacgagctgtatattgtttcacagttcttcgtagaagaatgg
aggaaatttgtcaggaggccgacgcggtgcagccccgtttcctcgttggggaacagtgct
ctgctctgcccccacgggggcctcatgttcacctacgcttccatgaccaaagaagactcc
aagcttatagctctaatatggcccagcgagtgggagaggattcaaaaactctttgtggtg
gatcacgtcatcaaaatcacccgcacgcgagctgccggggagcccgagaatgcactgtac
agctccgagccccaactctgtccagaatgcagagaagggctgttatgccaacagcagcgg
gacttgcgtgagtacacccaagcaaccatctacatccataaagtggtggataataaaaag
gtaatgaaggatgctgctccggagctgaacgtgagcagctcagaagctgaagaggaaagg
gaggaaaacaagccagagggggagcaagacccagattttaaccagagcaacggcggtgcg
aagcgccagaagctttcacaccagagctacatctcctaccaaaagcagggcatccggcgg
agcacccggcaccggaaggtcagaggagagaaagcgctgctcgtttctgctaaccagaca
ttgaaagagctgaaaatacagatcatgcatgcattttcagttgctcccttcgaccagaac
ttgtcgatcaatgggaagatcctgagcgacgacacggcgacgctcggcagcctgggcgtc
atccccgagtccgtcatcctgctcaaggctgatgagccaattgcggattatgcagcgatg
gacgatgtatccccagtttgtatgcctgaagaaggatttaaagggactggcttactcgga
cactga

DBGET integrated database retrieval system