KEGG   Meleagris gallopavo (turkey): 100549427Help
Entry
100549427         CDS       T01523                                 

Definition
(RefSeq) aromatase
  KO
K07434  
aromatase [EC:1.14.14.14]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Module
C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100549427
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.14  aromatase
     100549427
Cytochrome P450 [BR:mgp00199]
 Cytochrome P450, animal type
  CYP19 family
   100549427
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
12
AA seq 502 aa AA seqDB search
MIPETLNSLNYFTSLVPDLMPVATVPIIILICLLFLIWNHEETSSIPGPGYCMGIGPLIS
HGRFLWMGVGNACNYYNKTYGEFVRVWISGEETFIISKSSSVFHVMKHWNYVSRFGSKLG
LQCIGMYENGIIFNNNPAHWKEIRPFFTKALSGPGLVRMIAICVESTIVHLDKLEEVTTE
VGNVNVLNLMRRIMLDTSNKLFLGVPLDESAIVLKIQNYFDAWQALLLKPDIFFKISWLC
KKYEEAAKDLKGAMEILIEQKRQKLSSVEKLDEHMDFASQLIFAQNRGDLTAENVNQCVL
EMMIAAPDTLSVTLFFMLILIAEHPTVEEMMMREIETVMGDRDVQSDDMPNLKIVENFIY
ESMRYQPVVDLIMRKALQDDVIDGYPVKKGTNIILNIGRMHKLEFFPKPNEFSLENFEKN
VPSRYFQPFGFGPRGCVGKFIAMVMMKAILVTLLRRCRVQTMKGRGLNNIQKNNDLSMHP
IERQPLLEMVFTPRSPDKSQSD
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgataccagaaactttgaattcactaaactacttcaccagcctggtaccagacttgatg
cccgttgccacagtgcctatcatcattctcatctgccttctgtttctaatatggaatcac
gaagaaacatcatcaataccagggccaggatactgcatgggaattgggcccctcatttca
catgggagatttctctggatgggagtaggtaacgcctgcaactactacaacaagacatat
ggagaattcgtaagagtttggatcagcggtgaagaaacatttataattagcaaatcctca
agcgtattccatgtaatgaaacactggaactacgtttctcgatttgggagcaaacttgga
ttgcagtgcattggcatgtatgaaaatgggattatatttaataacaacccagcacactgg
aaggaaatccgacccttcttcaccaaagccctgtctggtcccggtcttgtgcgcatgata
gccatttgtgttgaatcaacaattgttcacctggacaaactagaagaagtgaccactgaa
gtaggaaatgtcaatgtgttgaatctcatgagacggatcatgcttgacacatctaacaag
ctctttctaggggtccctttggatgaaagtgccattgttcttaagattcagaactacttt
gatgcttggcaagctcttctattaaagcccgacatattttttaagatttcttggctttgc
aagaagtatgaagaggcagccaaagatttgaaaggagcaatggaaatcttaatagaacag
aagcgacaaaagctttcctctgttgaaaagttggatgagcacatggattttgcatctcag
ctgatttttgcacagaacagaggagatctgactgctgagaatgtgaaccagtgtgtgctg
gagatgatgatcgctgctcctgacactctatctgtgactctcttctttatgctaatactg
attgcagagcaccccacagtggaggagatgatgatgagagaaattgaaactgttatgggt
gacagagatgtacagagtgatgacatgccaaacctcaaaattgtggagaattttatttat
gagagcatgagataccagccagttgtggacttaatcatgagaaaagctttgcaagatgat
gtaattgatggctaccctgtgaaaaaggggacaaacattattcttaacattggacgtatg
cacaagcttgaattcttcccaaaaccgaatgagttttctcttgaaaactttgagaagaat
gttccatcacgctatttccagccatttggatttggcccccggggctgtgtaggaaagttt
attgccatggtaatgatgaaagcaattctggtgactcttctgagacggtgcagagtacag
acaatgaaaggaagaggacttaacaacatccagaaaaacaatgacttatccatgcaccca
atagaaaggcagcctctgctggagatggtttttacaccaagaagcccagacaagagtcag
agtgattaa

DBGET integrated database retrieval system