KEGG   Meleagris gallopavo (turkey): 100549427Help
Entry
100549427         CDS       T01523                                 

Definition
cytochrome P450 19A1-like
Orthology
K07434  
aromatase [EC:1.14.14.14]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:mgp00140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
12
AA seq 507 aa AA seqDB search
MIPETLNSLNYFTSLVPDLMPVATVPIIILICLLFLIWNHEETSSIPGPGYCMGIGPLIS
HGRFLWMGVGNACNYYNKTYGEFVRVWISGEETFIISKSSSVFHVMKHWNYVSRFGSKLG
LQCIGMYENGIIFNNNPAHWKEIRPFFTKALSGPGLVRMIAICVESTIVHLDKLEEVTTE
VGNVNVLNLMRRIMLDTSNKLFLGVPLDESAIVLKIQNYFDAWQALLLKPDIFFKISWLC
KKYEEAAKDLKGAMEILIEQKRQKLSSVEKLDEHMDFASQLIFAQNRGDLTAENVNQCVL
EMMIAAPDTLSVTLFFMLILIAEHPTVEEMMMREIETVMGDRDVQSDDMPNLKIVENFIY
ESMRYQPVVDLIMRKALQDDVIDGYPVKKGTNIILNIGRMHKLEFFPKPNEFSLENFEKN
VPSRYFQPFGFGPRGCVGKFIAMVMMKAILVTLLRRCRVQTMKGRGLNNIQKNNDLSMHP
IERQPLLEMVFTQEAQTRVRVIKADQH
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgataccagaaactttgaattcactaaactacttcaccagcctggtaccagacttgatg
cccgttgccacagtgcctatcatcattctcatctgccttctgtttctaatatggaatcac
gaagaaacatcatcaataccagggccaggatactgcatgggaattgggcccctcatttca
catgggagatttctctggatgggagtaggtaacgcctgcaactactacaacaagacatat
ggagaattcgtaagagtttggatcagcggtgaagaaacatttataattagcaaatcctca
agcgtattccatgtaatgaaacactggaactacgtttctcgatttgggagcaaacttgga
ttgcagtgcattggcatgtatgaaaatgggattatatttaataacaacccagcacactgg
aaggaaatccgacccttcttcaccaaagccctgtctggtcccggtcttgtgcgcatgata
gccatttgtgttgaatcaacaattgttcacctggacaaactagaagaagtgaccactgaa
gtaggaaatgtcaatgtgttgaatctcatgagacggatcatgcttgacacatctaacaag
ctctttctaggggtccctttggatgaaagtgccattgttcttaagattcagaactacttt
gatgcttggcaagctcttctattaaagcccgacatattttttaagatttcttggctttgc
aagaagtatgaagaggcagccaaagatttgaaaggagcaatggaaatcttaatagaacag
aagcgacaaaagctttcctctgttgaaaagttggatgagcacatggattttgcatctcag
ctgatttttgcacagaacagaggagatctgactgctgagaatgtgaaccagtgtgtgctg
gagatgatgatcgctgctcctgacactctatctgtgactctcttctttatgctaatactg
attgcagagcaccccacagtggaggagatgatgatgagagaaattgaaactgttatgggt
gacagagatgtacagagtgatgacatgccaaacctcaaaattgtggagaattttatttat
gagagcatgagataccagccagttgtggacttaatcatgagaaaagctttgcaagatgat
gtaattgatggctaccctgtgaaaaaggggacaaacattattcttaacattggacgtatg
cacaagcttgaattcttcccaaaaccgaatgagttttctcttgaaaactttgagaagaat
gttccatcacgctatttccagccatttggatttggcccccggggctgtgtaggaaagttt
attgccatggtaatgatgaaagcaattctggtgactcttctgagacggtgcagagtacag
acaatgaaaggaagaggacttaacaacatccagaaaaacaatgacttatccatgcaccca
atagaaaggcagcctctgctggagatggtttttacacaagaagcccagacaagagtcaga
gtgattaaagcagatcagcattaa

DBGET integrated database retrieval system