KEGG   Meleagris gallopavo (turkey): 100549468Help
Entry
100549468         CDS       T01523                                 

Definition
galactocerebrosidase-like
Orthology
K01202  
galactosylceramidase [EC:3.2.1.46]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:mgp00600]
Cellular Processes; Transport and catabolism; Lysosome [PATH:mgp04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 675 aa AA seqDB search
MEVVRRSLCPAALLCAWLLLGSSWGLGPPGIGAAYVLDDAGGLGREFDGIGAISGGGATS
RLLVNYQEPYRSQILDYLFKPNFGASLHILKVEIGGDGQSTDGTEPSHMHYENDENYFRG
YEWWLMKEAKKRNPQIKLIGLPWTFPSWIGKGENWPYDYPHVTVYYIISWILGAKQYHDL
DIDYIGIWNERAFNSKYIKLLRYTLDKNGLQQVRIIASDRLWEPISFVLLIDSELHEVVD
VIGAHYPGTKTVLNALLTQKKLWASEDYSTFNDEVGAGCWARILNQNYVNGNMTSTIAWN
LVASYYEELPFGRCGLMTAQEPWSGHYKVEAPIWITAHTTQFTQPGWSYLQVDGHLEGGG
SFVALTDGLGNLTIIIETMTHNHSKCIRPPLPHFRVSPQRATFYLRGSFYFLKTLQVWYS
RLGFESANSSLFEQLQPVKVWRGSFSLDLDVDEVYTLTTLKTGRKCNCPEPPPPQPFPSN
YKDDFNIRNPPFSEAPNFADQTGVFEYFVNGSDPGDHVFTLRQVVIQRPITWVSDADQTI
SIIGNFQWVNLTVTCDIYIEKPLDGGVFIAGRVDNGGIYVRRTKGVFFWVYADGTYRVTS
DLAGEEILMKGLSGVRDNAWHTLTLNIQGTSASGLLNGYPLWENVTISQPSNGWAAIGTR
SFEFAQFDNFHVEAR
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggaggttgtcaggcgttctctctgtcctgcggctctgctctgtgcttggctcctgctc
ggctccagctgggggttgggaccccccgggatcggtgctgcctacgtgctggatgatgcc
ggcgggctgggcagggagttcgacgggatcggggcgatcagcggcggcggggccacatct
agactccttgtgaactaccaagagccgtatcgctcccagatcttagattatctgttcaag
ccaaattttggtgcttctttacacattctcaaagtagagattggtggtgatggacaatca
acagatggcactgagccttcccatatgcactatgaaaatgatgagaactacttccgaggt
tatgaatggtggctgatgaaagaagctaagaagaggaacccccaaattaaactgattgga
ttaccctggacatttccatcatggatagggaagggtgaaaactggccttatgattatcca
catgtcactgtttactatattatttcttggatattaggagctaaacagtatcatgatctg
gatattgattatattgggatatggaatgaaagggcatttaacagcaaatatatcaagctg
ttgaggtacacactggataagaatggtctgcagcaggtgaggatcatagccagcgataga
ctgtgggagcccatttcctttgtcttgctgattgactctgaactccatgaagtggtcgat
gtcattggggctcactatcctgggacaaaaacagtgctaaatgccttactgactcagaag
aaactgtgggcttcagaagattatagtactttcaacgatgaagtaggtgcaggctgttgg
gctcggatcctaaaccaaaactacgtgaatggaaacatgacctcaactattgcatggaac
ttagtggcaagttattatgaagaattaccctttggtcgatgtggtttgatgacagcacaa
gaaccatggagtggccactataaagtagaagcacctatttggattacagcgcacacaaca
caatttactcaaccaggatggtcatacttgcaagtggatggacacttagaaggaggtgga
agctttgtagctctgacagacggtctaggaaaccttacaataataattgaaactatgaca
cataatcactctaaatgtatcagacctccactgcctcacttccgagtttcacctcagcga
gcaactttctacctcagagggtctttttatttcctgaaaactcttcaggtgtggtactct
aggcttggttttgaatctgcaaattctagtctttttgagcaacttcaacctgtaaaggtc
tggaggggaagtttttctttagatctagatgtggatgaagtctatactttaactacactt
aaaacaggacggaagtgtaactgcccagagcctccaccacctcaaccctttccttcaaat
tataaagatgactttaatattcgtaatccacctttcagtgaagctccaaattttgcagat
cagacgggtgtgtttgagtacttcgtaaatggctctgacccaggagatcatgttttcaca
ctccgacaggtagtgattcagcgacccatcacttgggtttctgatgcagaccagacaatc
agcatcataggaaactttcagtgggtaaacctgacagtcacttgtgacatctacatagaa
aaaccgcttgatgggggtgtgttcattgctggaagagtagacaatggtgggatatatgtt
cgtcgtaccaaaggtgttttcttctgggtttatgcagatggcacctacagagtcactagt
gacctagctggagaagaaatattaatgaaagggctttctggtgtccgagataatgcttgg
cacacacttactctcaacatccagggaacctctgcctcaggactgttaaatggttatcca
ctctgggagaacgtcaccatttctcagccaagtaatggctgggctgctattggaactcgc
tcgtttgagttcgcacagtttgacaacttccatgttgaagctagatga

DBGET integrated database retrieval system