KEGG   Meleagris gallopavo (turkey): 100549535Help
Entry
100549535         CDS       T01523                                 

Definition
ubiquitin carboxyl-terminal hydrolase 7-like
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
FoxO signaling pathway
Herpes simplex infection
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:mgp04068]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:mgp05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
16
AA seq 1077 aa AA seqDB search
MAGDADDPPRITQNPVINGNVAMADGHNNTEEDMEDDTSWRSEATFQFTVERFNRLSESV
LSPPCFVRNLPWKIMVMPRLYPDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYKD
DEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIEEDKVTFEVYVQADAPHGVAW
DSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFY
ELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFR
GKMVSYIQCKHVDYRSERIEDYYDIQLSIKGKKNIFESFIDYVAVEQLDGDNKYDAGEHG
LQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKTDPKDP
ANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDL
SVRHCTNAYMLVYIRESKLSEVLQPVTDHDIPQQLVERLQEEKRIEAQKRKERQEAHLYM
QVQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLKNSTLTEFVQNLSQTMGFPQDQIRLWPM
QARSNGTKRPAMLDNEADGNKTMIELSDNENPWTIFLETVDPEMAATGATLPKFDKDHDV
MLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVMCERAGFPQETNLILYEEVKPNLTER
IQDYDVSLDKALDELMDGDIIVFQKDDPENDNSELPTAKEYFRDLYHRVDVIFCDKTIPN
DPGFVVTLSNRMNYFQVAKTVAQRLNTDPMLLQFFKSQGYRDGPGNPLRHNYEGTLRDLL
QFFKPRQPKKLYYQQLKMKITDFENRRSFKCIWLNSQFREEEITVYPDKHGCVRDLLEEC
KKVVELSEKGSGKLRLLEIVSYKIIGVHQEDELLECLSPATSRTFRIEEIPLDQVDIDKE
NEMLITVAHFHKEVFGTFGIPFLLRIHQGEHFREVMKRIQTMLDIQEKEFEKFKFAIVMM
GRHQYLNEDEYEVNLKDFEPQPGNMSHPRPWLGLDHFNKAPKRSRYTYLEKAIKIHN
NT seq 3234 nt NT seq  +upstreamnt  +downstreamnt
atggctggagatgcagatgatcctccaagaattactcaaaatcctgtcattaatgggaat
gtagcaatggctgatggacacaacaacaccgaagaagacatggaggatgatacaagttgg
cgatcggaggcaacctttcagttcacagtcgaacgcttcaacagattgagtgaatcagtt
ctcagccctccctgctttgtacggaatttgccatggaagatcatggtcatgccacgactc
tacccggacagacctcaccaaaaaagcgtaggattcttcctccagtgcaatgcagaatct
gattccacgtcatggtcttgtcatgcacaagcagttctcaagataataaactacaaagat
gatgaaaaatcattcagtcgtcgtattagtcacttgttctttcataaggaaaatgattgg
ggcttttccaactttatggcctggagtgaagttactgatcctgaaaagggctttatagaa
gaggataaagttacttttgaagtctatgttcaagcagatgctccccatggagtggcgtgg
gattcaaagaagcacacaggatatgttggcttaaagaaccagggagcaacttgttacatg
aacagtttgttacagactttatttttcacaaatcaactacgaaaggctgtgtacatgatg
cccactgaaggagatgattcatccaaaagtgttcctttagcattgcaaagagtgttttat
gagctgcaacatagtgacaaaccagttggaactaaaaaattaacaaaatcttttgggtgg
gaaactttagacagcttcatgcaacacgatgtccaggagctatgtcgagtgctgcttgat
aatgtggaaaataaaatgaaaggcacatgtgtagaaggcactattccgaagttgttcaga
ggaaagatggtgtcttatatccaatgcaaacatgtagactatcgatctgaacgaatagaa
gattattatgatatccagctaagtataaagggaaagaaaaatatttttgagtccttcatt
gactatgttgcagtggagcagttggatggtgataacaagtatgatgcaggagagcatggc
ttgcaggaggcagagaaaggtgtgaagttcctaacattgccaccagtactacatctacag
ctcatgagatttatgtatgatccgcagactgatcaaaacatcaagataaatgataggttt
gagtttcctgaacagttgccactagatgaatttttgcaaaaaacagatcctaaagatcct
gcaaattacattcttcacgcagttctagtacacagtggagataaccatggtggacattat
gttgtttacttaaatccaaagggtgatggaaaatggtgtaaatttgatgatgacgttgta
tcaagatgtacaaaggaagaagcaattgaacacaactatggaggccacgacgacgacttg
tctgtacggcactgcaccaacgcgtacatgttggtttacatcagggaatcaaaattaagt
gaagtcttgcagcctgtcacggaccacgatattcctcaacaacttgtggaaaggctacaa
gaagagaaaagaatagaggctcagaagaggaaggagaggcaggaagctcacctctacatg
caagtgcagatagtagcagaggatcagttctgtggccaccaaggcaatgacatgtatgat
gaagaaaaagtgaaatacaccgttttcaaagtattaaaaaactccacgctgacagaattt
gttcagaacctctctcaaacaatgggatttccccaggatcagatcagattatggccaatg
caagctagaagtaatggaacaaaaagacctgcaatgttagataatgaagcagatggcaat
aaaacaatgattgagctcagtgacaatgaaaatccatggacaatatttttggaaacagta
gatccagagatggctgctaccggagcaacattacccaagtttgataaagatcatgatgta
atgttgtttctgaagatgtatgatccgaaaactcggagtttgaattattgtggacatatc
tacacacctatatcctgtaaaatacgtgacttgcttccagttatgtgtgagagagcagga
tttccacaagaaactaaccttatcctctatgaggaagttaaacccaatttaacagaaagg
attcaagactatgatgtgtctcttgataaagctcttgatgaactcatggatggtgacatc
atagtgtttcagaaggatgacccagaaaacgataacagtgagctgccaacagctaaggaa
tacttcagagacctctatcatcgtgtggatgtcattttctgtgataaaaccatccccaac
gacccaggctttgttgttactttatccaataggatgaattactttcaggttgcaaagaca
gttgcacaaagacttaatacagatccaatgctattacagtttttcaagtctcaaggttac
agggacggccctggtaatccccttaggcacaattatgaaggtactttaagagatcttctg
cagttcttcaagcctagacaacctaaaaagctttactatcaacagctcaaaatgaaaata
actgattttgaaaacagaagaagttttaaatgcatatggctaaatagccaatttagggaa
gaggaaataacagtatatccagataagcatgggtgtgtgcgggacctcttagaagaatgt
aaaaaagttgtagagctctctgaaaaaggttcagggaaattaaggctgctagaaattgta
agttacaaaataattggtgtccatcaggaagatgagctgttagagtgtttgtcacccgca
acaagtcgaacgtttcgaatagaggaaattcctctggaccaggtagatatagataaagaa
aatgagatgctaatcacagtggcacatttccacaaagaggtttttgggacatttggaatt
ccattcttgctgaggatacaccagggcgaacacttcagagaggttatgaagcggattcag
acaatgctggacatacaggaaaaagaatttgaaaagtttaaatttgcaattgtaatgatg
ggtcgacaccagtatctcaatgaagatgagtatgaagtgaacttgaaagattttgagccc
caacctggcaacatgtctcatccaaggccgtggctagggcttgaccatttcaataaagcc
ccaaagagaagtcgctacacttaccttgaaaaagctattaaaatccataactga

DBGET integrated database retrieval system