KEGG   Meleagris gallopavo (turkey): 100549535Help
Entry
100549535         CDS       T01523                                 

Gene name
USP7
Definition
(RefSeq) ubiquitin specific peptidase 7
  KO
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
FoxO signaling pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100549535 (USP7)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    100549535 (USP7)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100549535 (USP7)
Peptidases [BR:mgp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100549535 (USP7)
Ubiquitin system [BR:mgp04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100549535 (USP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
16
AA seq 520 aa AA seqDB search
MYDEEKVKYTVFKVLKNSTLTEFVQNLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEA
DGNKTMIELSDNENPWTIFLETVDPEMAATGATLPKFDKDHDVMLFLKMYDPKTRSLNYC
GHIYTPISCKIRDLLPVMCERAGFPQETNLILYEEVKPNLTERIQDYDVSLDKALDELMD
GDIIVFQKDDPENDNSELPTAKEYFRDLYHRVDVIFCDKTIPNDPGFVVTLSNRMNYFQV
AKTVAQRLNTDPMLLQFFKSQGYRDGPGNPLRHNYEGTLRDLLQFFKPRQPKKLYYQQLK
MKITDFENRRSFKCIWLNSQFREEEITVYPDKHGCVRDLLEECKKVVELSEKGSGKLRLL
EIVSYKIIGVHQEDELLECLSPATSRTFRIEEIPLDQVDIDKENEMLITVAHFHKEVFGT
FGIPFLLRIHQGEHFREVMKRIQTMLDIQEKEFEKFKFAIVMMGRHQYLNEDEYEVNLKD
FEPQPGNMSHPRPWLGLDHFNKAPKRSRYTYLEKAIKIHN
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgtatgatgaagaaaaagtgaaatacaccgttttcaaagtattaaaaaactccacgctg
acagaatttgttcagaacctctctcaaacaatgggatttccccaggatcagatcagatta
tggccaatgcaagctagaagtaatggaacaaaaagacctgcaatgttagataatgaagca
gatggcaataaaacaatgattgagctcagtgacaatgaaaatccatggacaatatttttg
gaaacagtagatccagagatggctgctaccggagcaacattacccaagtttgataaagat
catgatgtaatgttgtttctgaagatgtatgatccgaaaactcggagtttgaattattgt
ggacatatctacacacctatatcctgtaaaatacgtgacttgcttccagttatgtgtgag
agagcaggatttccacaagaaactaaccttatcctctatgaggaagttaaacccaattta
acagaaaggattcaagactatgatgtgtctcttgataaagctcttgatgaactcatggat
ggtgacatcatagtgtttcagaaggatgacccagaaaacgataacagtgagctgccaaca
gctaaggaatacttcagagacctctatcatcgtgtggatgtcattttctgtgataaaacc
atccccaacgacccaggctttgttgttactttatccaataggatgaattactttcaggtt
gcaaagacagttgcacaaagacttaatacagatccaatgctattacagtttttcaagtct
caaggttacagggacggccctggtaatccccttaggcacaattatgaaggtactttaaga
gatcttctgcagttcttcaagcctagacaacctaaaaagctttactatcaacagctcaaa
atgaaaataactgattttgaaaacagaagaagttttaaatgcatatggctaaatagccaa
tttagggaagaggaaataacagtatatccagataagcatgggtgtgtgcgggacctctta
gaagaatgtaaaaaagttgtagagctctctgaaaaaggttcagggaaattaaggctgcta
gaaattgtaagttacaaaataattggtgtccatcaggaagatgagctgttagagtgtttg
tcacccgcaacaagtcgaacgtttcgaatagaggaaattcctctggaccaggtagatata
gataaagaaaatgagatgctaatcacagtggcacatttccacaaagaggtttttgggaca
tttggaattccattcttgctgaggatacaccagggcgaacacttcagagaggttatgaag
cggattcagacaatgctggacatacaggaaaaagaatttgaaaagtttaaatttgcaatt
gtaatgatgggtcgacaccagtatctcaatgaagatgagtatgaagtgaacttgaaagat
tttgagccccaacctggcaacatgtctcatccaaggccgtggctagggcttgaccatttc
aataaagccccaaagagaagtcgctacacttaccttgaaaaagctattaaaatccataac
tga

DBGET integrated database retrieval system