KEGG   Meleagris gallopavo (turkey): 100549541Help
Entry
100549541         CDS       T01523                                 

Definition
alkaline phosphatase, tissue-nonspecific isozyme-like
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100549541
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     100549541
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100549541
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
23
AA seq 215 aa AA seqDB search
MKAFLLTLLAQLCSASLVPEREKDPEYWRQQAQETLRDALRLQHLNQNVAKNLILFLGDG
MGVSTVTAARILKGQLQHRKGEESLLEMDKFPYVALAKTYNTNAQVPDSAGTATAYLCGV
KANEGTVGVSAGVTRDRCNTTKGQEVTSILRWAKDEGKAVGIVTTTRVTHATPSAAYAHS
ANRDWYSDGEMPLDALEGGCKDIARQLVENIPDIE
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcttttctcctcacactcctggcccaactctgctcggcatcgctggttcctgag
agggagaaggaccccgagtactggaggcagcaggcacaggagacgctgcgggatgcactg
aggctgcagcacctcaaccagaacgtggccaagaacctcatcctcttcctgggcgacggt
atgggtgtctccaccgtgacggccgcacgcatcctcaagggccagctgcagcaccgcaag
ggcgaggagagcctgctggagatggacaagttcccatatgtcgccctggccaagacctac
aacaccaatgcacaggtgcccgacagcgcgggcacagccaccgcctacctctgtggtgtc
aaagccaacgaggggacagtgggtgtcagcgccggtgtcacccgtgaccgctgcaacacc
accaagggccaggaggtgacctccatcctccgctgggctaaggatgaaggcaaggcggtg
ggcattgtcaccaccacgcgggtgacccacgcgacgcccagcgcagcctacgcgcactcg
gccaaccgtgactggtactcagatggagagatgcccctggatgcactggagggtggctgc
aaagacatcgcccggcagctggtggagaacatccctgacatagag

DBGET integrated database retrieval system