KEGG   Meleagris gallopavo (turkey): 100549585Help
Entry
100549585         CDS       T01523                                 

Gene name
EIF3B
Definition
(RefSeq) eukaryotic translation initiation factor 3, subunit B
  KO
K03253  
translation initiation factor 3 subunit B
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100549585 (EIF3B)
Messenger RNA biogenesis [BR:mgp03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100549585 (EIF3B)
Translation factors [BR:mgp03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100549585 (EIF3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
16
AA seq 685 aa AA seqDB search
MPSSGYFHPAVHKEKMPPEDELSFSDPEGFVDDISDEELLGDVLKDQPQEADGIDSVIVV
DNVPQVGPDRLEKLKNVIHKIFSKFGKIINEFYPEADGKTKGYIFLEYMSPSHAVDAVKN
ADGYKLDKQHTFRVNLFTDFDKYMTISDEWEIPEKQPFKDLGNLRYWLEDPDCRDQYSVI
FESGDRTSIFWNDIKEPVQIEDRARWTETYVRWSPKGTYLATFHQRGIALWGGEKFKQIQ
RFSHQGVQLIDFSPCERYLVTFSPLMDTQDDPQAIIIWDILTGQKKRGFHCENSAHWPIF
KWSHDGKFFARMTSDTLSIYETPSMGLLDKKSLKINGIRDFSWSPGGNIIAFWVPEDKDI
PARVTLMQLPARQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTPKGTQGVVTNFEIFRM
REKQVPVDVVEMKESIIAFAWEPNGSKFAVLHGETPRISVSFYHVKNNGKIELIKTFDKQ
QANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTMMNIAEHYTASDVEWDPTGRYIVTS
VSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPATLLSEDQIKQIKKDLKKYSK
IFEQKDRLSQSKASKELVERRRTMMEEFRKYRKMAQELYMEQRNERLELRGGVDTDELDS
NVDDWEEETVEFFINEEIITLAEPE
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgccaagttcaggatatttccatccggctgtgcataaggaaaaaatgccacccgaggac
gagctttccttcagcgatcccgagggcttcgtggacgacatcagcgacgaagaattactt
ggtgatgtactgaaagaccagccgcaggaagcagatggaattgattcagtgatagtggtg
gataacgttccccaggttggaccagaccgacttgagaaactcaagaatgtcatccacaaa
atattttccaagtttggtaaaattataaacgaattttatccagaagcagatgggaagaca
aaagggtacatctttctggagtacatgtctccatctcacgcagtggatgctgtgaagaat
gcagatggatacaaactggataagcagcacactttcagagtcaatcttttcacagacttt
gacaagtatatgacgatcagtgacgagtgggaaatccctgagaaacagccatttaaagat
ttggggaatcttcgttactggttggaagatcctgattgtagagatcagtacagtgtgatc
tttgagtcaggagaccggacctccattttttggaatgatatcaaggagcctgttcaaatt
gaggacagagcacggtggacagaaacctacgtacgttggtctcccaagggtacctatctg
gctacattccaccagaggggcatcgcactttggggtggagagaagttcaagcagattcaa
aggtttagtcaccaaggagtacagcttattgacttctcgccctgtgagagatatttagtg
accttcagccctttgatggacacgcaggatgaccctcaggctattatcatctgggatatt
ctgactgggcaaaagaaacgaggattccactgtgaaaactcggctcactggcctattttt
aaatggagtcatgatgggaaattctttgctcgaatgacttcagataccctcagcatctat
gaaacaccttctatgggattgttggacaaaaaaagcttgaaaatcaatgggataagagat
ttctcatggtctccaggtggtaacataattgctttctgggtgcctgaggacaaagacatc
ccagcaagagtgaccttaatgcagctgcctgccagacaagagatccgtgtgcggaatttg
ttcaatgttgtagattgtaaactacactggcagaagaatggtgattacctgtgtgtgaag
gtagacaggactcccaaaggcacacagggagtagtgaccaactttgaaatattccgaatg
agagagaaacaggtgcctgtggatgtggtggaaatgaaagaaagcatcatagcctttgct
tgggaaccaaatggaagcaagtttgctgtgttgcatggagaaactccacgaatttcagtt
tccttttaccacgttaaaaacaatgggaaaatagaactcatcaaaacgtttgacaaacag
caggcaaacacgatattctggagtcctcaaggtcaatttgtagtgttggctggcctcaga
agcatgaacggtgccttagcatttgttgatacatctgattgcaccatgatgaatattgct
gaacactatacagcttcagatgtggaatgggatcctacaggcagatacattgtgacttct
gtatcttggtggagccataaggtggacaatgcatattggttatggaccttccaaggacgt
ctgcttcagaagaacaataaggacaggttctgtcagcttctgtggagaccacgaccagct
accttgctcagtgaggatcagataaagcaaattaagaaggatctgaagaagtactcaaag
atatttgagcagaaggatcgcctgagccagtccaaagcttcaaaagagctggtggagagg
agacgtacgatgatggaagaattcaggaagtaccgcaagatggcacaagagttgtacatg
gagcaaaggaacgagcgcttagagcttcggggaggggtagacacggatgagctggacagc
aatgttgatgactgggaggaggagactgttgaattttttatcaatgaagaaattattaca
cttgcagagccagagtaa

DBGET integrated database retrieval system