KEGG   Meleagris gallopavo (turkey): 100549585Help
Entry
100549585         CDS       T01523                                 

Definition
eukaryotic translation initiation factor 3 subunit B-like
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100549585
Messenger RNA biogenesis [BR:mgp03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100549585
Translation factors [BR:mgp03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100549585
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
16
AA seq 755 aa AA seqDB search
MTETQRDAGALAISAMQAHMLEQNSTVLCCSTTGSHFRGSRSKPASQKGAVPNTTHLLLR
AAGICTNATLLLPIEPLCLPFIASCDSMAPAAPRSGAQHQPMSYCRPELLGDVLKDQPQE
ADGIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKIINEFYPEADGKTKGYIFLEYMS
PSHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWEIPEKQPFKDLGNLRYWLED
PDCRDQYSVIFESGDRTSIFWNDIKEPVQIEDRARWTETYVRWSPKGTYLATFHQRGIAL
WGGEKFKQIQRFSHQGVQLIDFSPCERYLVTFSPLMDTQDDPQAIIIWDILTGQKKRGFH
CENSAHWPIFKWSHDGKFFARMTSDTLSIYETPSMGLLDKKSLKINGIRDFSWSPGGNII
AFWVPEDKDIPARVTLMQLPARQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTPKGTQG
VVTNFEIFRMREKQVPVDVVEMKESIIAFAWEPNGSKFAVLHGETPRISVSFYHVKNNGK
IELIKTFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTMMNIAEHYTASDVEW
DPTGRYIVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPATLLSEDQIKQ
IKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEEFRKYRKMAQELYMEQRNERLELR
GGVDTDELDSNVDDWEEETVEFFINEEIITLAEPE
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgactgagacgcaacgtgacgcaggagctttggctatttctgccatgcaggcacacatg
cttgaacagaattccacggtcctgtgttgctcaaccactggctcacatttcagaggaagt
cgcagcaaaccagcctctcaaaaaggagctgttccaaacacaacccacctgcttctgaga
gcagcagggatctgcaccaacgcgaccctcctgctgcctattgagcctctctgcctgcct
ttcattgccagctgcgattccatggcacccgctgctccccgatcaggggctcagcaccag
ccgatgagctactgcaggcctgaattacttggtgatgtactgaaagaccagccgcaggaa
gcagatggaattgattcagtgatagtggtggataacgttccccaggttggaccagaccga
cttgagaaactcaagaatgtcatccacaaaatattttccaagtttggtaaaattataaac
gaattttatccagaagcagatgggaagacaaaagggtacatctttctggagtacatgtct
ccatctcacgcagtggatgctgtgaagaatgcagatggatacaaactggataagcagcac
actttcagagtcaatcttttcacagactttgacaagtatatgacgatcagtgacgagtgg
gaaatccctgagaaacagccatttaaagatttggggaatcttcgttactggttggaagat
cctgattgtagagatcagtacagtgtgatctttgagtcaggagaccggacctccattttt
tggaatgatatcaaggagcctgttcaaattgaggacagagcacggtggacagaaacctac
gtacgttggtctcccaagggtacctatctggctacattccaccagaggggcatcgcactt
tggggtggagagaagttcaagcagattcaaaggtttagtcaccaaggagtacagcttatt
gacttctcgccctgtgagagatatttagtgaccttcagccctttgatggacacgcaggat
gaccctcaggctattatcatctgggatattctgactgggcaaaagaaacgaggattccac
tgtgaaaactcggctcactggcctatttttaaatggagtcatgatgggaaattctttgct
cgaatgacttcagataccctcagcatctatgaaacaccttctatgggattgttggacaaa
aaaagcttgaaaatcaatgggataagagatttctcatggtctccaggtggtaacataatt
gctttctgggtgcctgaggacaaagacatcccagcaagagtgaccttaatgcagctgcct
gccagacaagagatccgtgtgcggaatttgttcaatgttgtagattgtaaactacactgg
cagaagaatggtgattacctgtgtgtgaaggtagacaggactcccaaaggcacacaggga
gtagtgaccaactttgaaatattccgaatgagagagaaacaggtgcctgtggatgtggtg
gaaatgaaagaaagcatcatagcctttgcttgggaaccaaatggaagcaagtttgctgtg
ttgcatggagaaactccacgaatttcagtttccttttaccacgttaaaaacaatgggaaa
atagaactcatcaaaacgtttgacaaacagcaggcaaacacgatattctggagtcctcaa
ggtcaatttgtagtgttggctggcctcagaagcatgaacggtgccttagcatttgttgat
acatctgattgcaccatgatgaatattgctgaacactatacagcttcagatgtggaatgg
gatcctacaggcagatacattgtgacttctgtatcttggtggagccataaggtggacaat
gcatattggttatggaccttccaaggacgtctgcttcagaagaacaataaggacaggttc
tgtcagcttctgtggagaccacgaccagctaccttgctcagtgaggatcagataaagcaa
attaagaaggatctgaagaagtactcaaagatatttgagcagaaggatcgcctgagccag
tccaaagcttcaaaagagctggtggagaggagacgtacgatgatggaagaattcaggaag
taccgcaagatggcacaagagttgtacatggagcaaaggaacgagcgcttagagcttcgg
ggaggggtagacacggatgagctggacagcaatgttgatgactgggaggaggagactgtt
gaattttttatcaatgaagaaattattacacttgcagagccagagtaa

DBGET integrated database retrieval system