KEGG   Meleagris gallopavo (turkey): 100549618Help
Entry
100549618         CDS       T01523                                 

Gene name
UCHL1
Definition
ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase)
Orthology
K05611  
ubiquitin carboxyl-terminal hydrolase L1 [EC:3.4.19.12]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100549618 (UCHL1)
Peptidases [BR:mgp01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   100549618 (UCHL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 224 aa AA seqDB search
GVRGAAPPLARCAPQVLSRLGVSPGWRFVDVLGFEEEALGAVPSPACALLLLFPLTEQHE
NFRKQQTEKIKDQEISSKVYFLKQTVSNSCGTIGLIHAVANNKDKVKLDEGSALKKFLDE
TADLSPEERAKRFANNKAIQEVHNSVAQEGQCRVEDNSVNFHFILFANVDGHLYELDGRL
PFPVNHGTSSDDLLLKDSAKICRQFTEREKGEVRFSAVAFCKSA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
ggggtgcggggagcggctccgccactcgctcgctgtgctccgcaggtgctgtcccgcctc
ggggtgagccccggctggcgcttcgtggacgtgctgggcttcgaggaggaggcgctgggc
gctgtgcccagcccggcctgtgccctgctgctgctctttcccctcaccgagcagcatgag
aactttaggaaacaacagactgagaaaataaaggaccaagaaatcagttccaaggtgtat
ttcctgaagcagactgtcagtaactcctgtgggacaattggtctgatacacgcggttgct
aataacaaagacaaagttaaacttgatgagggatctgccttgaagaagtttcttgatgaa
acagctgatctgtctcctgaagagagagctaagcgttttgcaaataataaggctatacaa
gaagtccacaactctgttgcacaagaaggacagtgtcgggttgaggacaacagtgtgaac
ttccacttcatcctgtttgctaatgtggatggacatctgtatgaactggatgggcgttta
ccgtttcctgtaaaccatggcacaagctcagatgacttgctattgaaggattctgctaag
atctgcagacaatttacagaacgtgaaaaaggagaagtccgtttttctgctgtggctttc
tgcaagtctgcctga

DBGET integrated database retrieval system