KEGG   Meleagris gallopavo (turkey): 100549620Help
Entry
100549620         CDS       T01523                                 

Gene name
CHRM4
Definition
cholinergic receptor, muscarinic 4
Orthology
K04132  
muscarinic acetylcholine receptor M4
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Neuroactive ligand-receptor interaction
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100549620 (CHRM4)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100549620 (CHRM4)
G protein-coupled receptors [BR:mgp04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Acetylcholine (muscarinic) [OT]
    100549620 (CHRM4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 529 aa AA seqDB search
MLWDSHGCLWAEAVTKCAVFPVLDFLFQKELFAARDTDPMHNLSAQPWQAKMANLTYDNI
TLSNHSEVAIQPPTNYKTVELVFIATVTGSLSLVTVVGNILVMLSIKVNRQLQTVNNYFL
FSLACADLIIGVFSMNLYTVYIIKGYWPLGAVVCDLWLALDYVVSNASVMNLLIISFDRY
FCVTKPLTYPARRTTKMAGLMIAAAWILSFILWAPAILFWQFIVGKRTVHERECYIQFLS
NPAVTFGTAIAAFYLPVVIMTVLYIHISLASRSRVRRHKPESRKERKGKSLSFFKAPPVK
QNNNNSPKRAVEVKEEVRNGKVDDQPSAQTEATGQQEEKETSNESSTVSMTQTTKDKPTT
EILPAGQGQSPAHPRVNPTSKWSKIKIVTKQTGTECVTAIEIVPAKAGASDHNSLSNSRP
ANVARKFASIARSQVRKKRQMAAREKKVTRTIFAILLAFILTWTPYNVMVLINTFCETCV
PETVWSIGYWLCYVNSTINPACYALCNATFKKTFKHLLMCQYRNIGTAR
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgggattcacatggatgtctttgggctgaagctgtaacaaaatgtgctgttttc
cctgtcctagatttcctcttccagaaggagctgtttgctgccagagacacagaccccatg
cacaacctctccgcacagccctggcaggcgaagatggccaacctgacttatgacaacatc
accctcagcaatcactccgaggtggccatccagccccccaccaactacaagacggtggag
ctggttttcatcgccacggtcaccggctcgctcagcctcgtcaccgtggtggggaacatc
ctggtgatgctgtccatcaaggtgaaccgccaactgcagactgtcaacaactacttcctc
ttcagcctagcctgcgccgacctcatcatcggggtcttctccatgaacctctacacggtc
tacatcatcaaaggctactggccactgggggccgtggtttgtgacctgtggctggccctg
gactacgtggtgagcaacgcctcagtcatgaacttactcatcatcagctttgaccggtac
ttctgtgtcactaagcccctgacgtacccggccaggaggaccaccaagatggcggggctc
atgatcgcagccgcgtggatattgtccttcattctctgggcccctgccatcttgttctgg
cagttcattgtgggcaagaggacggtccacgagagggaatgctacatccagttcctttcc
aacccggcggtgaccttcggcacggccatcgctgctttctacctgcccgtggtcatcatg
acggtgctgtacatccacatctcactggccagcaggagcagggtgaggagacacaagccc
gaaagtaggaaagagaggaaaggcaagtccctcagcttcttcaaggctcccccagtcaaa
cagaacaacaataactcccccaagagggctgtggaggtgaaggaggaggtgaggaatggg
aaggtggatgaccagccctcagcacagacagaggccactggccagcaggaggagaaggag
acctccaatgagtccagcacagtcagcatgacccagaccaccaaagacaagcccacaacg
gaaatcttgccagcgggacaaggacagagcccagcccatcctcgggtgaacccgacttcc
aagtggtccaagatcaaaatcgtcaccaagcagactgggaccgaatgtgtcaccgccatc
gagatcgtcccagctaaggcaggagcctctgaccacaactccctgtccaacagccgccct
gccaatgtcgccaggaagtttgccagcatcgccaggagccaagtgcggaagaaacgccag
atggcagcccgggagaagaaggtcacccgcaccatatttgccattctgctagccttcata
ctcacatggactccttacaacgtgatggtcctcattaacaccttctgtgagacctgcgtt
cctgaaaccgtgtggtccatcggctactggctctgctacgtcaacagcaccatcaaccca
gcctgctatgccctctgcaatgccacgttcaagaaaacctttaagcacctcctcatgtgc
cagtacaggaacattggcacggccaggtaa

DBGET integrated database retrieval system