KEGG   Meleagris gallopavo (turkey): 100549645Help
Entry
100549645         CDS       T01523                                 

Gene name
DLAT
Definition
(RefSeq) dihydrolipoamide S-acetyltransferase
  KO
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100549645 (DLAT)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100549645 (DLAT)
   00020 Citrate cycle (TCA cycle)
    100549645 (DLAT)
   00620 Pyruvate metabolism
    100549645 (DLAT)
Enzymes [BR:mgp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     100549645 (DLAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
26
AA seq 625 aa AA seqDB search
MKSCCSNVSGWIHTARRASIQLAGIRIYFCPPTPILRADAVTRSMLNYIFVEAPDVALFM
SYAIRTIAALSPTMQMGTIACWEKKEGDKIGEGDLIAEVETDKATVGFESLEECYLAKIL
VPEGTRDVPIGAIICITVEKPEHVDAFKNYTLDSAVSAPPAASMPPPPAAAPSPPPPPSP
QAPGSSYPPHMQVALPALSPTMTMGTVQRWEKKVGEKLNEGDLLAEIETDKATIGFEVQE
EGYLAKILVPEGTRDVPLGTTLCIIVEKESDIPAFADYRETAVTDMKAQVPPPPPPSPVV
ATPAAAAPPSPQPAAPPTPAVATAGPPPRKGRIPVSPLAKKLAAEKGIDLAQVKGTGPDG
RITKKDVESFVPPRVAPAPAVEAVPAAAAVAAAPVGTFTDIPISNIRRVIAQRLMQSKQT
IPHYYLSVDVNMGEVLMLRKELNQVVSDNVKLSVNDFIIKASALACLKVPEANSSWMDTV
IRQNHVVDVSVAVSTPAGLITPIVFNAHIKGLASISKDVVSLATKAREGKLQPHEFQGGT
FTISNLGMYGIKNFSAIINPPQACILAVGSSEKKLVPADNEKGFDVASMMSVTLSCDHRV
VDGAVGAQWLAEFKNFLEKPVTMLL
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcgtgctgcagtaacgtcagcgggtggattcacactgcgcgcagggcttccatt
cagttggctggaattcgtatttacttctgcccgcccactcctatacttcgagctgacgct
gtgacacgttctatgctaaattatattttcgtagaagctccagacgtggcgctcttcatg
tcctacgcgatccgcaccatcgccgcgctgtcccccaccatgcagatgggcaccatcgcg
tgctgggagaaaaaggagggcgacaagatcggtgaaggggatctcatcgcggaggtggag
acagacaaagcaacagttggctttgagagtttggaggaatgctacttggccaaaatcctg
gtaccggagggaacaagagatgttcctattggggccataatatgtatcacagtagaaaag
cctgaacatgttgatgcctttaaaaattacactctggattctgcagtatctgctccccct
gcagcctcaatgcctccccctccagctgcagcaccctcacccccacctccgccttctcct
caggctcctggcagctcttatcctcctcatatgcaggttgctctccctgctctgtcaccc
accatgacaatgggcacagtgcagaggtgggaaaagaaggtcggggagaaactgaatgag
ggagacttactagcagaaattgagacagataaagccacaataggctttgaagtgcaggag
gaaggctacttggcaaaaatattggtgcctgaaggaacaagagatgtgccattaggaaca
accctctgcatcattgtggagaaagagtctgatattcctgcctttgctgactaccgagag
actgcagtaacagatatgaaggcacaagttcctcctcctccccctccttcaccagtggtg
gcaactcctgctgctgctgctcctccttctccccagcctgctgctcctccaactccagca
gtcgcaacagctgggccacctccccggaagggaaggatcccggttagtcccctagcgaag
aaactggcagcagaaaaaggaattgatcttgcccaagtgaaaggtactggaccagatggt
agaatcacaaagaaagatgtggagtcatttgtgccaccacgggttgccccagctccggca
gtagaagcagtacctgcagctgctgcagttgcagcagcaccagtggggaccttcacagat
atcccgatcagcaacattcggagggtcattgctcagcggctgatgcagtctaaacaaaca
atacctcactactacctttctgttgatgtaaacatgggagaagtactgatgctacgaaaa
gaactcaatcaggtggtctcagataatgttaagctttctgtcaatgacttcataattaaa
gcttctgctctggcatgcttgaaggtgcctgaggcaaattcttcatggatggacacagtt
attaggcaaaatcatgtagtggatgttagcgttgcagtgagcactcctgcagggcttata
actcctattgtgtttaatgcacatataaagggcctggcttctatcagtaaggacgtggtc
tctttggcaactaaagcccgagaaggtaaacttcagccacatgaattccagggtggtact
ttcacaatttccaatttaggaatgtatgggattaagaatttctctgccataatcaatccg
cctcaagcctgcatccttgcagttggttcctcagagaaaaagctagtgccagctgacaat
gagaaaggatttgatgtggccagtatgatgtccgttacactgagctgtgaccatcgtgtt
gtagatggagctgttggagcacagtggcttgctgaattcaagaatttccttgaaaagcca
gtaaccatgctgctataa

DBGET integrated database retrieval system