KEGG   Meleagris gallopavo (turkey): 100549684Help
Entry
100549684         CDS       T01523                                 

Gene name
PLCG2
Definition
(RefSeq) phospholipase C gamma 2
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00562  Inositol phosphate metabolism
mgp01100  Metabolic pathways
mgp04012  ErbB signaling pathway
mgp04020  Calcium signaling pathway
mgp04070  Phosphatidylinositol signaling system
mgp04370  VEGF signaling pathway
mgp04625  C-type lectin receptor signaling pathway
mgp04933  AGE-RAGE signaling pathway in diabetic complications
Module
mgp_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100549684 (PLCG2)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    100549684 (PLCG2)
   04370 VEGF signaling pathway
    100549684 (PLCG2)
   04020 Calcium signaling pathway
    100549684 (PLCG2)
   04070 Phosphatidylinositol signaling system
    100549684 (PLCG2)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    100549684 (PLCG2)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100549684 (PLCG2)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100549684 (PLCG2)
Membrane trafficking [BR:mgp04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100549684 (PLCG2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100549684 (PLCG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 SH3_9 SH3_2 PH PH_12 EF-hand_like
Motif
Other DBs
NCBI-GeneID: 100549684
NCBI-ProteinID: XP_010716385
Ensembl: ENSMGAG00000006882
Position
13
AA seq 1265 aa AA seqDB search
MPRKSIDYGELPEYEKSQIKRTLELGTVMTVFSIKKSSPERRTIQVIMETRQVAWSKTAD
KIEGFLDLMEIKEIRPGKNSKDFERCKAKHREEHCFTIFYGTQFVLNTLSLAADSKDDAD
KWLCGLNILYQEVMRAPTPAITESWLRKQIYSVDQTRRNSISLRELKAILPQVNFKVSSM
KFLKDKFAEIGAHKEELSFEQFHLFYKKIMFEQQKSILDEFKKDSSVFILGNTDRPDASA
VHLHDFQRFLLHEQQESWAQDLSKVRERMTEFVDDTMRETAEPFLFVDEFLTYLFAKENS
IWDEKYDTIDVQDMNNPLSHYWISSSHNTYLTGDQLRSESSTEAYVRCLRMGCRCIELDC
WDGPDGKPIIYHGWTRTTKIKFDDVVQAIKDHAFVASEYPVILSIEEHCSVEQQRHMAKV
FKEVFGDQLLMKPVEASADQLPSPTQLKEKIIIKHKKLGPKGDIDVNLEDKKEEKKQQGE
LYMWDAIEQQWTRHYCAIADGKLSFSDVIEQNAEEDSSKEVKHTELHLKEKWFHGKMKEG
RTTAEKLLQEYCAEMGGKDGTFLVRESEAFPNDCTLSFWRSGRVQHCRIRSSSDGDTVKY
YLTDNVTFDSIYDLIQHYKEVHLRCAEFELRLTDAVPNPSPHENKDWYYSNLSRGEAEDM
LMRIPRDGAFLIRKRDEPDSFAMTFRAEGKVKHFRIQQEGRHFVLGTSAYFESLVELVTY
YEKHPLYRKMKLRYPVTEELLERYSTEKDINSLYDVKMYVEPSEISPTVPQRTVKALYDY
RAKRSDELSFCRGALIHNVTKETGGWWKGDYGEKVQHYFPSNYVEDLSNDNSAELESQII
EDNPLGSLCHGILVLNTYNVVKMPQGKHKKPFVFILEPKNPEDPCVEFATDKVEELFEWY
QSVREITWKTAEEENRRKYWEKNQLIAIELSDLVIYCKPTSKTKDNLENPDFKEIRSFVE
TKAESIVKQKPVELLKYNLKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTPDKY
MQLNHALFSLNGRTGYVLQPESMRNEEYDPMPNESKRKLQMIMTVRVLGARHLPKLGRSI
ACPFVEVEICGAEYDNNKFKTTVVNDNGLNPVWAPCPEQVKFEIYDPNLAFLRFVVYEED
MFSDPNFLAHATFPIKGIKSGFRSVPLKNGYSEDIELASLLIHCEMQQVLEYEEELYSSC
RQLRKRQEELNNQLFLYDTHMNLRNPNRDALLREFNVNEHKLQMCQETCNRRLREKKVSN
SKFYS
NT seq 3798 nt NT seq  +upstreamnt  +downstreamnt
atgcccagaaagagtatagattatggagagctgccggagtatgagaaaagccagatcaaa
aggacattggagctgggaactgttatgactgtattcagtattaagaagagtagtccagaa
aggaggactattcaagttataatggaaaccaggcaggtagcctggagcaagacagctgac
aagatcgaaggtttcttggatctgatggaaataaaagaaattcgccccggaaagaattca
aaggactttgaacgatgcaaagcaaagcacagagaagaacactgcttcactattttttat
ggtacccagtttgtcctcaataccttaagtttagcagctgattctaaagatgatgctgat
aaatggttgtgtggcttgaatatcttgtatcaagaggtcatgcgagctccaacacctgca
atcacggagagctggctgagaaagcagatctattctgttgatcagactagaagaaatagt
atcagtcttagagagctgaaagctatccttccccaagtaaacttcaaagtgagcagcatg
aagttcttgaaggataaatttgcggaaataggtgctcacaaggaagagcttagttttgaa
caatttcatttgttctacaaaaagatcatgtttgaacaacagaaatcgattctcgatgaa
ttcaaaaaggattcctctgtgttcattcttggaaatactgaccgtccagatgcttcagca
gttcatctccatgactttcagaggtttctcctacatgagcagcaggagtcttgggcacaa
gatctgagtaaagtccgagaacgaatgactgagtttgtagatgacactatgagagaaact
gctgaacccttcctctttgttgatgagttcctcacttacctttttgcaaaagaaaacagt
atctgggatgagaaatatgatacaatagatgtgcaggacatgaataatcctttgtcccat
tactggatttcttcctctcataacacatatctgacaggagaccagcttcgaagtgaatcc
tccacggaagcttatgtcaggtgtcttagaatgggatgccgatgtattgagttggactgt
tgggatggtccagatgggaagcccatcatttaccatggatggacacggacaacaaagatc
aaatttgatgatgtagtacaggcaatcaaagatcatgcttttgttgcatctgaataccca
gtcattctgtcaattgaagagcactgtagtgtggaacagcaacgacacatggccaaagtg
ttcaaggaggtatttggggatcagcttttaatgaaacctgttgaagctagtgcagatcag
ctaccgtcaccaactcaactgaaagaaaaaatcatcatcaagcacaaaaaactgggacca
aagggagacattgatgtcaacctggaagacaagaaagaagaaaaaaagcaacaaggagaa
ctttacatgtgggatgcaatagaacagcaatggactcggcactactgtgctattgctgat
ggaaagctttcattcagtgatgtcatagaacagaatgcagaagaggactcatcaaaggag
gttaaacatactgaactgcacttaaaagagaaatggttccatggaaagatgaaagagggg
agaacaactgctgagaagctgctccaagaatattgtgctgaaatgggtggcaaggatggg
acattcctagttagggagagcgaggctttccctaatgattgcaccttgtcattctggaga
tcaggtagagtccagcactgccgtatccgttcttcaagtgatggtgacactgtgaaatac
tacctgacagacaatgtcacttttgatagcatctacgatctcattcaacactacaaggag
gtccacttgagatgtgctgaatttgagctgcgtctgactgacgctgtgcctaatcccagc
cctcatgaaaataaagattggtactatagcaacttgagtcgaggagaggcagaagacatg
ctgatgcgaattcctcgagatggagcctttctgattagaaagagagatgaacctgattca
tttgccatgactttcagagctgaggggaaggtgaagcacttccgaattcagcaagaaggt
cgccattttgtgcttggaacgtcagcctactttgagagtttagtggagctggtcacatac
tatgagaagcaccctctgtacaggaaaatgaaattgcgttatcccgtgactgaggagctg
ctggagcgctacagcacagaaaaagatataaattctctttatgatgtcaagatgtatgtg
gaacccagtgaaatctcccctacagtgcctcagagaacggtgaaagccttgtatgactac
agagccaaacgaagtgatgaattgagcttctgtcgaggagctctaattcataatgtcaca
aaggaaactggaggctggtggaagggggattatggagaaaaagtccaacactattttcca
tctaattatgttgaagacctgtcgaatgataattctgctgagcttgaaagccagattatt
gaggacaatccattaggctctctgtgtcacggcatattggtactaaatacgtacaatgtt
gtgaaaatgccacaagggaaacacaaaaagccttttgtcttcattttggaacctaagaat
ccagaagatccgtgtgttgaatttgcaactgataaagtagaagaactgtttgaatggtac
caaagtgtccgtgaaatcacatggaaaactgcagaagaggagaacaggaggaaatactgg
gaaaagaatcaattgattgccattgaattatctgatctggtaatctactgcaagccaaca
agcaaaaccaaggacaatttagaaaatcctgatttcaaagaaattcgttcctttgtggaa
accaaggcagaaagtattgttaagcaaaagccagttgagttgctgaaatacaacttgaag
ggactgacacgtgtctatcctaaaggacaaagggttgactcatcaaactatgacccattt
cgcctctggctttgtggctctcagatggtggctcttaactttcagactccagataaatac
atgcaattgaaccatgccttgttttcacttaatggacgcactggctatgttctgcagcca
gaaagcatgagaaatgaagaatatgacccaatgccaaatgaatcgaagaggaaattgcag
atgattatgacagtgagggttttaggtgctcgtcatctcccaaagcttggtagaagcatt
gcgtgtccctttgtagaggtggaaatatgtggggctgagtatgataataacaaattcaag
acaacagttgtgaatgacaatggccttaatccagtttgggcaccctgtccagagcaagtg
aaatttgaaatttatgatccaaatctagcatttttgcgctttgttgtttatgaggaggat
atgttcagtgaccccaatttcttagcacatgccacttttcccatcaaaggcatcaaatca
ggttttagatcagttcctctcaagaacggttacagtgaagacatagagctagcctcactt
ctgattcactgtgaaatgcagcaagttctggaatatgaagaagagctttattcttcgtgt
cggcaacttcggaagcgccaggaggaacttaataaccagctgttcctttatgatacccat
atgaatttaaggaatcctaacagagatgcattattaagagaattcaatgtgaatgaacac
aaactacagatgtgtcaagaaacatgtaaccggagattaagggagaagaaagtcagtaac
agcaaattctactcttaa

DBGET integrated database retrieval system