KEGG   Meleagris gallopavo (turkey): 100549684Help
Entry
100549684         CDS       T01523                                 

Gene name
PLCG2
Definition
phospholipase C, gamma 2 (phosphatidylinositol-specific)
Orthology
K05859  
phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Inositol phosphate metabolism
Metabolic pathways
ErbB signaling pathway
Calcium signaling pathway
Phosphatidylinositol signaling system
VEGF signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100549684 (PLCG2)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    100549684 (PLCG2)
   04370 VEGF signaling pathway
    100549684 (PLCG2)
   04020 Calcium signaling pathway
    100549684 (PLCG2)
   04070 Phosphatidylinositol signaling system
    100549684 (PLCG2)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100549684 (PLCG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
13
AA seq 1265 aa AA seqDB search
MPRKSIDYGELPEYEKSQIKRTLELGTVMTVFSIKKSSPERRTIQVIMETRQVAWSKTAD
KIEGFLDLMEIKEIRPGKNSKDFERCKAKHREEHCFTIFYGTQFVLNTLSLAADSKDDAD
KWLCGLNILYQEVMRAPTPAITESWLRKQIYSVDQTRRNSISLRELKAILPQVNFKVSSM
KFLKDKFAEIGAHKEELSFEQFHLFYKKIMFEQQKSVLDEFKKDSSVFILGNTDRPDASA
VHLHDFQRFLLHEQQESWAQDLSKVRERMTEFVDDTMRETAEPFLFVDEFLTYLFAKENS
IWDEKYDTIDVQDMNNPLSHYWISSSHNTYLTGDQLRSESSTEAYVRCLRMGCRCIELDC
WDGPDGKPIIYHGWTRTTKIKFDDVVQAIKDHAFVASEYPVILSIEEHCSVEQQRHMAKV
FKEVFGDQLLMKPVEASADQLPSPTQLKEKIIIKHKKLGPKGDIDVNLEDKKEEKKQQGE
LYMWDAIEQQWTRHYCAIADGKLSFSDVIEQNAEEDSSKEVKHTELHLKEKWFHGKMKEG
RTTAEKLLQEYCAEMGGKDGTFLVRESEAFPNDCTLSFWRSGRVQHCRIRSSSDGDTVKY
YLTDNVTFDSIYDLIQHYKEVHLRCAEFELRLTDAVPNPSPHENKDWYYSNLSRGEAEDM
LMRIPRDGAFLIRKRDEPDSFAMTFRAEGKVKHFRIQQEGRHFVLGTSAYFESLVELVTY
YEKHPLYRKMKLRYPVTEELLERYSTEKDINSLYDVKMYVEPSEISPTVPQRTVKALYDY
RAKRSDELSFCRGALIHNVTKETGGWWKGDYGEKVQHYFPSNYVEDLSNDNSAELESQII
EDNPLGSLCHGILVLNTYNVVKMPQGKHKKPFVFILEPKNPEDPCVEFATDKVEELFEWY
QSVREITWKTAEEENRRKYWEKNQLIAIELSDLVIYCKPTSKTKDNLENPDFKEIRSFVE
TKAESIVKQKPVELLKYNLKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTPDKY
MQLNHALFSLNGRTGYVLQPESMRNEEYDPMPNESKRKLQMIMTVRVLGARHLPKLGRSI
ACPFVEVEICGAEYDNNKFKTTVVNDNGLNPVWAPCPEQVKFEIYDPNLAFLRFVVYEED
MFSDPNFLAHATFPIKGIKSGFRSVPLKNGYSEDIELASLLIHCEMQQVLEYEEELYSSC
RQLRKRQEELNNQLFLYDTHMNLRNPNRDALLREFNVNEHKLQMCQETCNRRLREKKVSN
SKFYS
NT seq 3798 nt NT seq  +upstreamnt  +downstreamnt
atgcccagaaagagtatagattatggagagctgccggagtatgagaaaagccagatcaaa
aggacattggagctgggaactgttatgactgtattcagtattaagaagagtagtccagaa
aggaggactattcaagttataatggaaaccaggcaggtagcctggagcaagacagctgac
aagatcgaaggtttcttggatctgatggaaataaaagaaattcgccccggaaagaattca
aaggactttgaacgatgcaaagcaaagcacagagaagaacactgcttcactattttttat
ggtacccagtttgtcctcaataccttaagtttagcagctgattctaaagatgatgctgat
aaatggttgtgtggcttgaatatcttgtatcaagaggtcatgcgagctccaacacctgca
atcacggagagctggctgagaaagcagatctattctgttgatcagactagaagaaatagt
atcagtcttagagagctgaaagctatccttccccaagtaaacttcaaagtgagcagcatg
aagttcttgaaggataaatttgcggaaataggtgctcacaaggaagagcttagttttgaa
caatttcatttgttctacaaaaagatcatgtttgaacaacagaaatcggttctcgatgaa
ttcaaaaaggattcctctgtgttcattcttggaaatactgaccgtccagatgcttcagca
gttcatctccatgactttcagaggtttctcctacatgagcagcaggagtcttgggcacaa
gatctgagtaaagtccgagaacgaatgactgagtttgtagatgacactatgagagaaact
gctgaacccttcctctttgttgatgagttcctcacttacctttttgcaaaagaaaacagt
atctgggatgagaaatatgatacaatagatgtgcaggacatgaataatcctttgtcccat
tactggatttcttcctctcataacacatatctgacaggagaccagcttcgaagtgaatcc
tccacggaagcttatgtcaggtgtcttagaatgggatgccgatgtattgagttggactgt
tgggatggtccagatgggaagcccatcatttaccatggatggacacggacaacaaagatc
aaatttgatgatgtagtacaggcaatcaaagatcatgcttttgttgcatctgaataccca
gtcattctgtcaattgaagagcactgtagtgtggaacagcaacgacacatggccaaagtg
ttcaaggaggtatttggggatcagcttttaatgaaacctgttgaagctagtgcagatcag
ctaccgtcaccaactcaactgaaagaaaaaatcatcatcaagcacaaaaaactgggacca
aagggagacattgatgtcaacctggaagacaagaaagaagaaaaaaagcaacaaggagaa
ctttacatgtgggatgcaatagaacagcaatggactcggcactactgtgctattgctgat
ggaaagctttcattcagtgatgtcatagaacagaatgcagaagaggactcatcaaaggag
gttaaacatactgaactgcacttaaaagagaaatggttccatggaaagatgaaagagggg
agaacaactgctgagaagctgctccaagaatattgtgctgaaatgggtggcaaggatggg
acattcctagttagggagagcgaggctttccctaatgattgcaccttgtcattctggaga
tcaggtagagtccagcactgccgtatccgttcttcaagtgatggtgacactgtgaaatac
tacctgacagacaatgtcacttttgatagcatctacgatctcattcaacactacaaggag
gtccacttgagatgtgctgaatttgagctgcgtctgactgacgctgtgcctaatcccagc
cctcatgaaaataaagattggtactatagcaacttgagtcgaggagaggcagaagacatg
ctgatgcgaattcctcgagatggagcctttctgattagaaagagagatgaacctgattca
tttgccatgactttcagagctgaggggaaggtgaagcacttccgaattcagcaagaaggt
cgccattttgtgcttggaacgtcagcctactttgagagtttagtggagctggtcacatac
tatgagaagcaccctctgtacaggaaaatgaaattgcgttatcccgtgactgaggagctg
ctggagcgctacagcacagaaaaagatataaattctctttatgatgtcaagatgtatgtg
gaacccagtgaaatctcccctacagtgcctcagagaacggtgaaagccttgtatgactac
agagccaaacgaagtgatgaattgagcttctgtcgaggagctctaattcataatgtcaca
aaggaaactggaggctggtggaagggggattatggagaaaaagtccaacactattttcca
tctaattatgttgaagacctgtcgaatgataattctgctgagcttgaaagccagattatt
gaggacaatccattaggctctctgtgtcacggcatattggtactaaatacgtacaatgtt
gtgaaaatgccacaagggaaacacaaaaagccttttgtcttcattttggaacctaagaat
ccagaagatccgtgtgttgaatttgcaactgataaagtagaagaactgtttgaatggtac
caaagtgtccgtgaaatcacatggaaaactgcagaagaggagaacaggaggaaatactgg
gaaaagaatcaattgattgccattgaattatctgatctggtaatctactgcaagccaaca
agcaaaaccaaggacaatttagaaaatcctgatttcaaagaaattcgttcctttgtggaa
accaaggcagaaagtattgttaagcaaaagccagttgagttgctgaaatacaacttgaag
ggactgacacgtgtctatcctaaaggacaaagggttgactcatcaaactatgacccattt
cgcctctggctttgtggctctcagatggtggctcttaactttcagactccagataaatac
atgcaattgaaccatgccttgttttcacttaatggacgcactggctatgttctgcagcca
gaaagcatgagaaatgaagaatatgacccaatgccaaatgaatcgaagaggaaattgcag
atgattatgacagtgagggttttaggtgctcgtcatctcccaaagcttggtagaagcatt
gcgtgtccctttgtagaggtggaaatatgtggggctgagtatgataataacaaattcaag
acaacagttgtgaatgacaatggccttaatccagtttgggcaccctgtccagagcaagtg
aaatttgaaatttatgatccaaatctagcatttttgcgctttgttgtttatgaggaggat
atgttcagtgaccccaatttcttagcacatgccacttttcccatcaaaggcatcaaatca
ggttttagatcagttcctctcaagaacggttacagtgaagacatagagctagcctcactt
ctgattcactgtgaaatgcagcaagttctggaatatgaagaagagctttattcttcgtgt
cggcaacttcggaagcgccaggaggaacttaataaccagctgttcctttatgatacccat
atgaatttaaggaatcctaacagagatgcattattaagagaattcaatgtgaatgaacac
aaactacagatgtgtcaagaaacatgtaaccggagattaagggagaagaaagtcagtaac
agcaaattctactcttaa

DBGET integrated database retrieval system