KEGG   Meleagris gallopavo (turkey): 100549763Help
Entry
100549763         CDS       T01523                                 

Definition
calpain-1 catalytic subunit-like
Orthology
K01367  
calpain-1 [EC:3.4.22.52]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100549763
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100549763
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     100549763
Peptidases [BR:mgp01002]
 Cysteine Peptidases
  Family C2: calpain family
   100549763
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 705 aa AA seqDB search
MMPFGGIAARLQRDRLRAEGVGEHNNAIKYLNQDYEALKQECIESGVLFRDPQFPAGPTA
LGFKELGPYSSKTRGVEWKRPSELVDDPQFIVGGATRTDICQGALGDCWLLAAIGSLTLN
EELLHRVVPHGQSFQEDYAGIFHFQIWQFGEWVDVVVDDLLPTKDGELLFVHSAECTEFW
SALLEKAYAKLNGCYESLSGGSTTEGFEDFTGGVAEMYDLKRAPHNMGHIIRKALERGSL
LGCSIDITSAFDMEAVTFKKLVKGHAYSVTAFKDVNYRGQQEQLIRIRNPWGQVEWTGAW
SDGSSEWDNIDPSDREELQLKMEDGEFWMSFRDFMREFSRLEICNLTPDALTKDELSRWH
TQVFEGTWRRGSTAGGCRNNPATFWINPQFKIKLLEEDDDPGDDEVACSFLVALMQKHRR
RERRVGGDMHTIGFAVYEVPEEAQGSQNVHLKKDFFLRNQSRARSETFINLREVSNQIRL
PPGEYIVVPSTFEPHKEADFILRVFTEKQSDTAELDEEISADLADEEEITEDDIEDGFKS
MFQQLAGEDMEISVFELKTILNRVIARHKDLKTDGFSLDSCRNMVNLMDKDGSARLGLVE
FQILWNKIRSWLTIFRQYDLDKSGTMSSYEMRMALESAGFKLNNKLHQVVVARYADAETG
VDFDNFVCCLVKLETMFRFFHSMDPDGTGTAVMNLAEWLLLTMCG
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgatgccctttggggggatcgctgcccggctgcagagggaccgcctgagagctgagggg
gtcggtgagcacaacaatgctatcaagtacctcaaccaggactatgaagccctcaagcaa
gagtgcatcgagagtggtgtcctcttcagggacccccagttcccagctggccccactgcc
ctcggcttcaaggaactggggccgtactccagcaagacgcggggcgtggagtggaagcgt
ccatcggaattagtggatgatcctcagttcattgttggtggtgcaacccggacagatatc
tgccagggagctctgggtgattgctggctgctggctgccattggctccctcactctcaac
gaggaactcctgcaccgtgtggtgccccacgggcagagcttccaggaggactacgctggc
atcttccacttccagatctggcagtttggtgagtgggtggacgtggtggtggacgacctg
ctgcccaccaaggatggggagctcctgtttgtgcattcagcggagtgcacagagttctgg
agtgctctgctggagaaggcctatgccaagctgaacggctgctacgagtcgctctcgggg
ggcagcaccactgagggctttgaggatttcactggcggcgtagcagagatgtatgacctc
aagcgggcaccgcacaacatgggccacatcatccgcaaagcactggagagggggtccctg
ctgggctgctccatcgacatcacaagtgcctttgatatggaagcagtgaccttcaagaag
ctggtgaagggccatgcctattctgtcacagctttcaaagatgtgaactaccggggtcag
caggaacagctcatccgtatcagaaacccttggggtcaggtggagtggactggagcctgg
agtgatggctcttccgagtgggacaacattgaccccagcgacagagaagagctgcaactg
aagatggaggatggagagttctggatgtctttccgggacttcatgagggagttctccagg
ctggagatctgcaacctaacccccgatgccctcaccaaagatgagctcagcaggtggcac
acacaggtgtttgagggcacatggcgccgagggagcactgccgggggctgcaggaacaac
ccagccacgttctggatcaatccccagtttaagatcaagctgctggaagaggatgatgac
cctggggatgacgaggtggcctgcagcttcttggtggccctgatgcagaagcatcgtagg
agggagcgacgagtagggggcgacatgcataccatcggctttgctgtctatgaggttcct
gaggaggcccagggcagccagaatgtgcacttgaagaaggacttcttcctgcgaaaccag
tcgcgggcacgctctgagaccttcatcaacttgagggaagtgagcaaccagatccggctg
ccccctggcgagtacatcgttgtaccctccacctttgagccacataaggaggctgacttc
atcctgcgggtcttcactgagaagcagtcagacactgcggagctggatgaggagatctct
gcagacctggcagatgaggaggaaataaccgaggatgacattgaggatggcttcaagagc
atgttccagcagctggcaggggaggacatggaaatcagcgtctttgagctcaagacgatt
ctgaacagagtgatcgctagacacaaagatctgaagacggatggattcagtctggactcc
tgccgcaacatggtcaacctgatggataaagatggcagtgcccgcctgggactggtggag
ttccagatcctgtggaacaagattcgcagctggctgacaatcttccgccagtatgacctg
gataagtcaggcaccatgagctcatatgagatgcgcatggctctagagtcagctggtttc
aagctgaataacaagctgcatcaggtggtggttgcccgttacgcagatgctgagacgggt
gtggactttgacaactttgtctgctgcttggtgaagctggagacaatgttcaggttcttc
catagcatggatcctgatggcactggcactgccgtcatgaacctcgctgagtggctgctg
ctgacaatgtgcggctag

DBGET integrated database retrieval system