KEGG   Meleagris gallopavo (turkey): 100549763Help
Entry
100549763         CDS       T01523                                 

Gene name
CAPN11
Definition
(RefSeq) calpain 11
  KO
K01367  
calpain-1 [EC:3.4.22.52]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Necroptosis
Cellular senescence
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100549763 (CAPN11)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100549763 (CAPN11)
   04217 Necroptosis
    100549763 (CAPN11)
   04218 Cellular senescence
    100549763 (CAPN11)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     100549763 (CAPN11)
Peptidases [BR:mgp01002]
 Cysteine Peptidases
  Family C2: calpain family
   100549763 (CAPN11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
2
AA seq 705 aa AA seqDB search
MMPFGGIAARLQRDRLRAEGVGEHNNAIKYLNQDYEALKQECIESGVLFRDPQFPAGPTA
LGFKELGPYSSKTRGVEWKRPSELVDDPQFIVGGATRTDICQGALGDCWLLAAIGSLTLN
EELLHRVVPHGQSFQEDYAGIFHFQIWQFGEWVDVVVDDLLPTKDGELLFVHSAECTEFW
SALLEKAYAKLNGCYESLSGGSTTEGFEDFTGGVAEMYDLKRAPHNMGHIIRKALERGSL
LGCSIDITSAFDMEAVTFKKLVKGHAYSVTAFKDVNYRGQQEQLIRIRNPWGQVEWTGAW
SDGSSEWDNIDPSDREELQLKMEDGEFWMSFRDFMREFSRLEICNLTPDALTKDELSRWH
TQVFEGTWRRGSTAGGCRNNPATFWINPQFKIKLLEEDDDPGDDEVACSFLVALMQKHRR
RERRVGGDMHTIGFAVYEVPEEAQGSQNVHLKKDFFLRNQSRARSETFINLREVSNQIRL
PPGEYIVVPSTFEPHKEADFILRVFTEKQSDTAELDEEISADLADEEEITEDDIEDGFKS
MFQQLAGEDMEISVFELKTILNRVIARHKDLKTDGFSLDSCRNMVNLMDKDGSARLGLVE
FQILWNKIRSWLTIFRQYDLDKSGTMSSYEMRMALESAGFKLNNKLHQVVVARYADAETG
VDFDNFVCCLVKLETMFRFFHSMDPDGTGTAVMNLAEWLLLTMCG
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgatgccctttggggggatcgctgcccggctgcagagggaccgcctgagagctgagggg
gtcggtgagcacaacaatgctatcaagtacctcaaccaggactatgaagccctcaagcaa
gagtgcatcgagagtggtgtcctcttcagggacccccagttcccagctggccccactgcc
ctcggcttcaaggaactggggccgtactccagcaagacgcggggcgtggagtggaagcgt
ccatcggaattagtggatgatcctcagttcattgttggtggtgcaacccggacagatatc
tgccagggagctctgggtgattgctggctgctggctgccattggctccctcactctcaac
gaggaactcctgcaccgtgtggtgccccacgggcagagcttccaggaggactacgctggc
atcttccacttccagatctggcagtttggtgagtgggtggacgtggtggtggacgacctg
ctgcccaccaaggatggggagctcctgtttgtgcattcagcggagtgcacagagttctgg
agtgctctgctggagaaggcctatgccaagctgaacggctgctacgagtcgctctcgggg
ggcagcaccactgagggctttgaggatttcactggcggcgtagcagagatgtatgacctc
aagcgggcaccgcacaacatgggccacatcatccgcaaagcactggagagggggtccctg
ctgggctgctccatcgacatcacaagtgcctttgatatggaagcagtgaccttcaagaag
ctggtgaagggccatgcctattctgtcacagctttcaaagatgtgaactaccggggtcag
caggaacagctcatccgtatcagaaacccttggggtcaggtggagtggactggagcctgg
agtgatggctcttccgagtgggacaacattgaccccagcgacagagaagagctgcaactg
aagatggaggatggagagttctggatgtctttccgggacttcatgagggagttctccagg
ctggagatctgcaacctaacccccgatgccctcaccaaagatgagctcagcaggtggcac
acacaggtgtttgagggcacatggcgccgagggagcactgccgggggctgcaggaacaac
ccagccacgttctggatcaatccccagtttaagatcaagctgctggaagaggatgatgac
cctggggatgacgaggtggcctgcagcttcttggtggccctgatgcagaagcatcgtagg
agggagcgacgagtagggggcgacatgcataccatcggctttgctgtctatgaggttcct
gaggaggcccagggcagccagaatgtgcacttgaagaaggacttcttcctgcgaaaccag
tcgcgggcacgctctgagaccttcatcaacttgagggaagtgagcaaccagatccggctg
ccccctggcgagtacatcgttgtaccctccacctttgagccacataaggaggctgacttc
atcctgcgggtcttcactgagaagcagtcagacactgcggagctggatgaggagatctct
gcagacctggcagatgaggaggaaataaccgaggatgacattgaggatggcttcaagagc
atgttccagcagctggcaggggaggacatggaaatcagcgtctttgagctcaagacgatt
ctgaacagagtgatcgctagacacaaagatctgaagacggatggattcagtctggactcc
tgccgcaacatggtcaacctgatggataaagatggcagtgcccgcctgggactggtggag
ttccagatcctgtggaacaagattcgcagctggctgacaatcttccgccagtatgacctg
gataagtcaggcaccatgagctcatatgagatgcgcatggctctagagtcagctggtttc
aagctgaataacaagctgcatcaggtggtggttgcccgttacgcagatgctgagacgggt
gtggactttgacaactttgtctgctgcttggtgaagctggagacaatgttcaggttcttc
catagcatggatcctgatggcactggcactgccgtcatgaacctcgctgagtggctgctg
ctgacaatgtgcggctag

DBGET integrated database retrieval system