KEGG   Meleagris gallopavo (turkey): 100549768Help
Entry
100549768         CDS       T01523                                 

Definition
serine/threonine-protein kinase mos-like
Orthology
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
Oocyte meiosis
Regulation of actin cytoskeleton
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100549768
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100549768
  Cell growth and death
   04114 Oocyte meiosis
    100549768
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100549768
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100549768
Protein kinases [BR:mgp01001]
 Serine/threonine protein kinases: Other group
  MOS family
   100549768
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 349 aa AA seqDB search
MPSPIPFNSFLPLELSPSADLRPCSSPAVIPGKDGKAFLGGTPSPRTRRLPPRLAWCSID
WDQLCLLQPLGSGGFGAVYKATYHGVTVAVKQVKKSSKNRLASRQSFWAELNVARLQHDN
VVRVVAASTCAPASQNSLGTIIMEYVGNITLHHVIYGTRDVWRQGEEEEGGCGRKGLSME
EAVCYSCDIVTGLAFLHSQGIVHLDLKPSNILITEHGACKIGDFGCSQRLEEGSSQSHHV
CQQGGTYTHRAPELLKGERVTAKADIYSFAITLWQIVMREQPYLGERQYVLYAVVAYNLR
PSLEATIFHESLVGQRLQRIISCCWKADVEERLSAAQLLPSLRALKGNS
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgccatcacctattccttttaatagctttcttcctttggagctctccccatctgcagac
ttgagaccttgcagcagccctgcagttatccctggcaaagatggaaaagccttcctagga
gggactccctctcccaggacacgtcgcctgcctccacgcttggcctggtgctccattgac
tgggatcagctctgcctcctgcagcccctgggctctgggggttttggggctgtctacaag
gccacctaccatggtgtgactgtggctgtgaagcaggtgaagaagagcagcaaaaaccgg
ctggcatcccgacagagtttctgggctgagctgaacgtagcccgactgcagcatgataat
gtggtgcgtgtggtggctgccagcacgtgtgctcctgccagccagaacagcctgggcacc
atcatcatggaatacgttggcaacatcaccctgcaccatgtcatctacggcactagagat
gtgtggaggcagggcgaggaggaagaaggaggatgtgggaggaagggtctgagcatggag
gaggctgtgtgctactcgtgtgacattgtgactggcttagccttccttcactcgcagggc
atcgtgcacctcgacctgaagccttccaatatcctcatcactgagcatggagcgtgcaag
atcggagacttcggctgctcccagagactggaggaaggctcgtcccagagccaccatgtt
tgtcagcaagggggcacgtatacccaccgcgctcctgagctcctcaagggtgagagggtc
actgccaaagcagacatctactcctttgccatcaccctctggcagattgtcatgcgggag
cagccctacctgggcgaacggcaatacgttctctatgcagtggtagcctacaacttacgc
ccttctctggaggccaccatcttccatgagtcactggtgggccaaaggcttcagagaatc
atcagctgctgctggaaggctgatgtagaggagcgcctcagtgcagcccagctgctcccc
agcctcagggccttgaagggaaactcctag

DBGET integrated database retrieval system