KEGG   Meleagris gallopavo (turkey): 100549777Help
Entry
100549777         CDS       T01523                                 

Gene name
PFKP
Definition
phosphofructokinase, platelet
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100549777 (PFKP)
   01230 Biosynthesis of amino acids
    100549777 (PFKP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100549777 (PFKP)
   00030 Pentose phosphate pathway
    100549777 (PFKP)
   00051 Fructose and mannose metabolism
    100549777 (PFKP)
   00052 Galactose metabolism
    100549777 (PFKP)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    100549777 (PFKP)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100549777 (PFKP)
Protein phosphatases and associated proteins [BR:mgp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100549777 (PFKP)
Messenger RNA biogenesis [BR:mgp03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100549777 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 422 aa AA seqDB search
MVDGGDNIVEVSWESVSSILQVGGTVIGSARCKSFRTREGRLQAACNLVQRGITNLCVIG
GDGSLTGANLFREEWSGLLEELAQKGKIDEEAVKKYAYLNIVGMVGSIDNDFCGTDMTIG
TDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPEYPPEE
GWEDSMCVKLSENRARKKRLNIIIVAEGAIDCHNKPITSEKVKDLVVQRLGFDTRVTILG
HVQRGGTPSAFDRILASRMGVEAVLALLEATPDTPACVVSLSGNQAVRLPLMECVQMTQE
VQKAMDEGRFVEAVRLRGRSFENNLNTYKLLSQKKPDAELPKTNFNVAVLNVGAPAAGMN
AAVRAAVRVGITEGHKMFAVIDGFEGFARGKVSIVLCIPSHSTILFMFLEVVFCGTLMRS
DS
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggttgatggcggtgataatattgttgaagtttcttgggaaagtgtatccagtatcctg
caagtgggaggtacagtgattggtagtgcacgctgcaaatcctttcgtacccgggagggt
cgcctgcaggcagcctgcaacttggttcagagaggaatcactaatctttgtgtgattggt
ggagatggtagcttaactggtgccaatctgttccgtgaagaatggagtggacttctagaa
gaactggcgcagaaaggaaagattgatgaagaagctgttaagaaatatgcttaccttaac
attgtgggaatggttgggtccatagacaatgacttctgtggtactgatatgaccatagga
actgactcagccttgcacagaatcattgaagttgtggatgccatcatgaccactgcacaa
agccatcagaggacatttgttctggaggttatggggagacactgtgggtatttagctctt
gtcagtgccttagcttgtggtgcagattgggtatttattcctgaatacccaccagaggaa
ggatgggaggattcaatgtgtgttaagctttcagagaaccgtgcacgaaagaaaaggctg
aatattattatcgtagctgaaggtgctattgactgccacaacaaacctataacatcagag
aaggttaaggatcttgtggttcagcggcttggattcgacacccgagtgactatcttgggt
catgtgcaaagaggtggaactccttcagcttttgatagaattttggcaagccgaatgggt
gtggaagctgtacttgcacttctagaagctactccagatactcctgcctgtgttgtgtct
ctgtctggaaaccaagctgtccgtctgcctttgatggagtgtgtgcagatgactcaagaa
gtacagaaagccatggatgaaggaagatttgttgaggctgtgaggcttcgtgggaggagc
tttgaaaacaaccttaacacctacaaattactgtcacaaaaaaagccagatgccgagctt
ccaaagaccaattttaatgtggcagtcttaaatgttggtgcacctgcagctggaatgaat
gctgcagtgagggctgcagtgagagttggcataactgaaggccataaaatgtttgctgtc
attgatggatttgaaggttttgctagagggaaggtcagtatagtattgtgtatcccatcc
cactctaccattttgttcatgttcttggaagttgtcttctgtggaactcttatgagaagt
gattcttaa

DBGET integrated database retrieval system