KEGG   Meleagris gallopavo (turkey): 100549777Help
Entry
100549777         CDS       T01523                                 

Gene name
PFKP
Definition
phosphofructokinase, platelet
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100549777 (PFKP)
   01230 Biosynthesis of amino acids
    100549777 (PFKP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100549777 (PFKP)
   00030 Pentose phosphate pathway
    100549777 (PFKP)
   00051 Fructose and mannose metabolism
    100549777 (PFKP)
   00052 Galactose metabolism
    100549777 (PFKP)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100549777 (PFKP)
Protein phosphatases and associated proteins [BR:mgp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100549777 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 760 aa AA seqDB search
MDHQPKFFENLSGTGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVKAKVYFVYEGGTVIGS
ARCKSFRTREGRLQAACNLVQRGITNLCVIGGDGSLTGANLFREEWSGLLEELAQKGKID
EEAVKKYAYLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLE
VMGRHCGYLALVSALACGADWVFIPEYPPEEGWEDSMCVKLSENRARKKRLNIIIVAEGA
IDCHNKPITSEKVKDLVVQRLGFDTRVTILGHVQRGGTPSAFDRILASRMGVEAVLALLE
ATPDTPACVVSLSGNQAVRLPLMECVQMTQEVQKAMDEGRFVEAVRLRGRSFENNLNTYK
LLSQKKPDAELPKTNFNVAVLNVGAPAAGMNAAVRAAVRVGITEGHKMFAVIDGFEGFAR
GKIKEISWGDVGGWTGQGGSILGTKRTLPAKYLEKIADQMRTNNINALMVIGGFEAYLGL
LELSAAREKYDEFCVPMVMVPATVSNNVPGSDFSIGADTALNTITDTCDRIKQSASGTKR
RVFIIETMGGYCGYLANMGALAAGADAAYIFEEQFDIRELQANVEHLTEKMKTSIQRGLV
LRNENCNENYTTDFIYQLYSEEGKGVFDCRKNVLGHMQQGGAPSPFDRNFGTKISAKAMQ
WISKKLKETYRKEEGKVFANTDDSVCLLGMRRRNLVFQPVAELKNETDFVHRIPMEQWWL
KLRPLMKILAKYKTSYDVSDSGQLEHVAMHSPKEAETGAI
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atggatcaccagcccaagttcttcgagaacctctccggcaccgggaaagccatcggggtg
ctgaccagcggcggcgatgcccaaggtatgaatgctgctgtgcgtgcagtagtacgcatg
ggaatatatgtgaaagccaaagtctatttcgtttatgagggaggtacagtgattggtagt
gcacgctgcaaatcctttcgtacccgggagggtcgcctgcaggcagcctgcaacttggtt
cagagaggaatcactaatctttgtgtgattggtggagatggtagcttaactggtgccaat
ctgttccgtgaagaatggagtggacttctagaagaactggcgcagaaaggaaagattgat
gaagaagctgttaagaaatatgcttaccttaacattgtgggaatggttgggtccatagac
aatgacttctgtggtactgatatgaccataggaactgactcagccttgcacagaatcatt
gaagttgtggatgccatcatgaccactgcacaaagccatcagaggacatttgttctggag
gttatggggagacactgtgggtatttagctcttgtcagtgccttagcttgtggtgcagat
tgggtatttattcctgaatacccaccagaggaaggatgggaggattcaatgtgtgttaag
ctttcagagaaccgtgcacgaaagaaaaggctgaatattattatcgtagctgaaggtgct
attgactgccacaacaaacctataacatcagagaaggttaaggatcttgtggttcagcgg
cttggattcgacacccgagtgactatcttgggtcatgtgcaaagaggtggaactccttca
gcttttgatagaattttggcaagccgaatgggtgtggaagctgtacttgcacttctagaa
gctactccagatactcctgcctgtgttgtgtctctgtctggaaaccaagctgtccgtctg
cctttgatggagtgtgtgcagatgactcaagaagtacagaaagccatggatgaaggaaga
tttgttgaggctgtgaggcttcgtgggaggagctttgaaaacaaccttaacacctacaaa
ttactgtcacaaaaaaagccagatgccgagcttccaaagaccaattttaatgtggcagtc
ttaaatgttggtgcacctgcagctggaatgaatgctgcagtgagggctgcagtgagagtt
ggcataactgaaggccataaaatgtttgctgtcattgatggatttgaaggttttgctaga
gggaagatcaaggaaatcagctggggagatgttggaggctggactggtcaaggaggatca
attcttggtaccaaacgtactcttcctgcaaaatatttggagaagattgctgatcagatg
cgcactaacaacattaatgctcttatggttattggtggatttgaggcgtacctcggactt
ttggaattgtcagctgcccgagagaaatatgatgaattctgtgttccaatggttatggtt
cctgcaacagtatccaacaatgtaccgggttcagatttcagcattggtgcagatactgct
ctgaacactataactgatacttgtgatcgcatcaaacagtcagccagtggtaccaaacga
cgtgtattcatcattgagaccatgggtggttactgtggttacctggccaatatgggagcc
cttgcagcaggagctgatgctgcttatatctttgaagaacagtttgacattcgagagctc
caggctaatgtggaacacttgactgaaaagatgaaaaccagtatccagcgtggtttagtg
ctgagaaatgagaattgcaatgagaactacacaactgacttcatttatcagctgtattct
gaagaaggaaaaggagtgtttgactgtcgaaaaaatgttctgggccacatgcagcagggt
ggggcaccttcaccatttgacagaaactttgggacaaagatttctgcgaaagctatgcag
tggatctccaaaaaactgaaggaaacctatcggaaagaagaaggaaaagtatttgccaat
accgatgattctgtctgtttgctgggaatgcgcagacgcaaccttgttttccaaccagta
gctgagctgaagaatgaaacagactttgtacataggattcccatggagcagtggtggctg
aagctgcggccactgatgaaaatcctggccaaatacaagaccagctatgatgtttcagac
tcgggccaactggagcatgttgctatgcacagcccaaaggaagcagaaaccggagccatc
taa

DBGET integrated database retrieval system