KEGG   Meleagris gallopavo (turkey): 100549829Help
Entry
100549829         CDS       T01523                                 

Definition
TGF-beta receptor type-2-like
Orthology
K04388  
TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Endocytosis
TGF-beta signaling pathway
Adherens junction
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:mgp04010]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:mgp04350]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:mgp04068]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:mgp04060]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:mgp04144]
Cellular Processes; Cell communication; Adherens junction [PATH:mgp04520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 573 aa AA seqDB search
MQKESHFELKLTESGQLLFPVPTACCAGARRSLKTNLCKWCDSTPPACEREVCYSNCNLN
SYCEDPFEICVAIWRQDNDSIRISTLCHNPHRPIENLMVPNYNTSRCIMTHQPSDDGIIY
ICGCVDEQECNDKLIFENHTNGYSMLQSKEVIPVAAISLLPPLLVAVMITVIFYLCRTQK
QRKRAKSWVGKQGQGPALQEPGRAAERDEKLSVLMDDGPATMNPTCANSLNHNTELLPIE
LDEMVGKGQFAEVWRAKLNHSSSGQYETVAVKIFPCEEYSSWKNESQIFTDASLKHDSVL
QFLTAEDRGSGPRREYWLITAYHSRGNLKDYLSRHILSWMDLQKMAGSLVNGVAHLHSDY
TACGRPKIPIAHRDIKSTNILVKNEQECVICDFGIAIRLDPSLTADDFANSGQVGTARYM
APEVLESRVNLEDLESFKQMDVYSMALVLWEMASRCEVVGEVKNYELPFGSKVQEQPCVD
TMRDIVLHGRGRPEIPSSWLVHQGMRFLCDTITECWDHDPEARLTAHCVAERFNLMAQMD
CDDILNNNTDNEVGKTASAGGEQQDNDGSRSMP
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaggagagtcactttgagctgaaactcactgaaagtggccaactgctgttccct
gtgcccacagcctgctgtgctggtgcacgccgcagcctgaagaccaacctgtgcaagtgg
tgtgactccacgccgccagcctgtgagcgggaggtgtgctacagcaactgcaacctcaac
tcctactgcgaggacccctttgagatctgcgtggccatatggagacaggacaacgacagc
atcaggatcagcacactctgccacaacccccaccgccccatagagaacctcatggtcccc
aactacaacacctcacgctgcatcatgacccaccagcccagcgatgatggtatcatctac
atctgtggctgtgtggatgagcaggagtgcaacgataagcttatctttgaaaatcatact
aatggctactccatgctgcagagcaaggaggtcatcccggtggctgccatcagcctcctg
ccgccgctgctggtggcggtgatgatcaccgtcatcttctacctctgccgcacacagaag
caacgcaagagagccaagagctgggttgggaagcaggggcagggtccagcactgcaggag
ccaggcagggctgccgaacgggacgagaagctgtccgtgctgatggatgatggcccggcc
accatgaaccccacctgcgccaacagcctcaaccacaacaccgagctgctgcccattgag
ctggatgagatggtgggcaaggggcaatttgcggaggtgtggagggctaagctgaaccac
agcagctcagggcagtatgagacagtggcagtgaagatcttcccctgtgaggagtattct
tcctggaagaacgagagccagatcttcacggatgccagcctcaagcatgacagtgttctg
cagttcctcacggctgaggacaggggctcagggccacgcagggaatactggctcatcact
gcctaccacagcaggggcaacctcaaggactatctctccagacacatcctgagttggatg
gacctgcaaaaaatggcagggtcactggtgaacggggtggcccatcttcacagtgattac
acagcctgtggccggccgaaaatccccattgctcacagggacatcaaaagcaccaacatc
ctggtgaagaacgagcaggagtgtgtgatctgtgacttcggcattgccatacgccttgac
ccctcactgacggcagatgactttgctaacagcgggcaggtgggcactgccaggtacatg
gccccagaggtcctggagtccagggtgaacctggaagatctggagtctttcaagcagatg
gacgtctattccatggccctcgttctgtgggaaatggcctccagatgtgaagtggtggga
gaggtaaagaattacgagctgccttttgggtcaaaagtgcaagagcaaccctgtgtggac
accatgagagacattgtgctgcatggcagagggcggcccgagatccctagcagctggctg
gtgcaccaggggatgcgcttcctgtgtgacaccatcacggagtgctgggaccacgacccc
gaggcccgcctcaccgcacactgcgtggccgagcgcttcaacctgatggcgcagatggat
tgcgacgacatcctcaacaacaacacggacaacgaggtcggcaaaacagcctctgcggga
ggggagcagcaggacaatgatgggagcaggagcatgccgtga

DBGET integrated database retrieval system