KEGG   Meleagris gallopavo (turkey): 100549831Help
Entry
100549831         CDS       T01523                                 

Gene name
STAMBPL1
Definition
STAM binding protein-like 1
Orthology
K11867  
AMSH-like protease [EC:3.4.19.12]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100549831 (STAMBPL1)
Peptidases [BR:mgp01002]
 Metallo Peptidases
  Family M67
   100549831 (STAMBPL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
8
AA seq 435 aa AA seqDB search
MEQPFSISSLKKLVAIPDHTDISVTPEERVRALSKLGSNIAINEDITPRRYFRSGVEMER
MASIYMEEGNLENAFVFYNKFITLFVEKLPSHRDYHQCAVPEKQVIIKKLKEVAFPRTDE
LKRDLLKKYSLEYQEYMQNKNKCKTESLKKLEQQKLIEAEKKRIAHMRQQQLESEQFQFF
EDQLKKQELARDQKIKESMVMSEQIDGSMLSCISVPENSSSPTTLLEKKEKSGICVSTGD
SPPVNRALKPAAALSAVQTQLAEALRGVILPRDLCHKFLLLAEANTLRGIETCGILCGKL
THNEFTITHVIVPKQSSGPDYCDMENVEELFGIQDQFDLLTLGWIHTHPTQTAFLSSVDL
HTHCSYQLMLPEAIAIVCSPKHNDTGIFRLTNAGMLEVSACKKKGFHPHTKDPRLFNPCT
HVVGKDIKIIVLDLR
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaccattcagtattagttccttgaaaaagcttgtagctattcctgaccacacg
gacatctctgtgaccccagaagagagagtgcgtgccctaagcaaacttggcagcaatatt
gcaatcaatgaggacatcactccacgtcgttacttcagatctggagtagaaatggagcga
atggcatcaatttacatggaggaaggaaatctggagaacgcttttgttttttataacaag
ttcataaccttgtttgtggaaaagctgcccagtcaccgagactatcaccaatgtgcagta
ccagaaaaacaagtcattattaagaaactgaaggaggttgcatttccacggacagatgaa
ctgaagagagatcttttaaaaaaatatagcttagaatatcaagaatacatgcaaaacaaa
aacaaatgtaaaactgaatctctgaagaaactagagcagcagaagctgatagaggcagag
aagaaacgaattgcacatatgaggcagcagcagcttgaatcagaacagtttcagttcttt
gaggatcagcttaagaagcaagaactggctcgagatcagaagattaaagagagcatggtt
atgtctgagcagatagatggaagtatgctatcctgtatttctgtacctgagaacagttcc
tcacctaccacactgctagagaaaaaagagaagagtggcatatgtgtctctactggagat
tcacctccagtaaaccgggccctaaaaccagcagctgctttaagtgctgttcagactcaa
ctggctgaagcactcagaggtgtaattttacccagggatctctgtcacaaatttctgctg
ctagcagaggcgaacacattaagaggaatagagacatgtggaattctctgtggaaaactg
acacacaatgaatttactattacccatgtaatagtgccaaagcaatcttcaggaccagac
tactgtgacatggagaacgtagaagaattatttggtattcaggatcagtttgatctcctc
actttgggttggatacatacacatccaacacaaaccgcattcttatccagtgttgatctt
catactcattgttcttatcagctcatgttaccagaggccattgcaattgtttgttcacca
aaacataacgatactggcatcttcagactgactaatgctggcatgcttgaagtttctgca
tgtaaaaagaagggatttcatccacatacaaaggatcccaggttatttaatccatgcacc
catgtggttgggaaggacataaagataattgtgctggatctgaggtga

DBGET integrated database retrieval system