KEGG   Meleagris gallopavo (turkey): 100549831Help
Entry
100549831         CDS       T01523                                 

Gene name
STAMBPL1
Definition
STAM binding protein-like 1
Orthology
K11867  
AMSH-like protease [EC:3.1.2.15]
Organism
mgp  Meleagris gallopavo (turkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
8
AA seq 435 aa AA seqDB search
MEQPFSISSLKKLVAIPDHTDISVTPEERVRALSKLGSNIAINEDITPRRYFRSGVEMER
MASIYMEEGNLENAFVFYNKFITLFVEKLPSHRDYHQCAVPEKQVIIKKLKEVAFPRTDE
LKRDLLKKYSLEYQEYMQNKNKCKTESLKKLEQQKLIEAEKKRIAHMRQQQLESEQFQFF
EDQLKKQELARDQKIKESMVMSEQIDGSMLSCISVPENSSSPTTLLEKKEKSGICVSTGD
SPPVNRALKPAAALSAVQTQLAEALRGVILPRDLCHKFLLLAEANTLRGIETCGILCGKL
THNEFTITHVIVPKQSSGPDYCDMENVEELFGIQDQFDLLTLGWIHTHPTQTAFLSSVDL
HTHCSYQLMLPEAIAIVCSPKHNDTGIFRLTNAGMLEVSACKKKGFHPHTKDPRLFNPCT
HVVGKDIKIIVLDLR
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaccattcagtattagttccttgaaaaagcttgtagctattcctgaccacacg
gacatctctgtgaccccagaagagagagtgcgtgccctaagcaaacttggcagcaatatt
gcaatcaatgaggacatcactccacgtcgttacttcagatctggagtagaaatggagcga
atggcatcaatttacatggaggaaggaaatctggagaacgcttttgttttttataacaag
ttcataaccttgtttgtggaaaagctgcccagtcaccgagactatcaccaatgtgcagta
ccagaaaaacaagtcattattaagaaactgaaggaggttgcatttccacggacagatgaa
ctgaagagagatcttttaaaaaaatatagcttagaatatcaagaatacatgcaaaacaaa
aacaaatgtaaaactgaatctctgaagaaactagagcagcagaagctgatagaggcagag
aagaaacgaattgcacatatgaggcagcagcagcttgaatcagaacagtttcagttcttt
gaggatcagcttaagaagcaagaactggctcgagatcagaagattaaagagagcatggtt
atgtctgagcagatagatggaagtatgctatcctgtatttctgtacctgagaacagttcc
tcacctaccacactgctagagaaaaaagagaagagtggcatatgtgtctctactggagat
tcacctccagtaaaccgggccctaaaaccagcagctgctttaagtgctgttcagactcaa
ctggctgaagcactcagaggtgtaattttacccagggatctctgtcacaaatttctgctg
ctagcagaggcgaacacattaagaggaatagagacatgtggaattctctgtggaaaactg
acacacaatgaatttactattacccatgtaatagtgccaaagcaatcttcaggaccagac
tactgtgacatggagaacgtagaagaattatttggtattcaggatcagtttgatctcctc
actttgggttggatacatacacatccaacacaaaccgcattcttatccagtgttgatctt
catactcattgttcttatcagctcatgttaccagaggccattgcaattgtttgttcacca
aaacataacgatactggcatcttcagactgactaatgctggcatgcttgaagtttctgca
tgtaaaaagaagggatttcatccacatacaaaggatcccaggttatttaatccatgcacc
catgtggttgggaaggacataaagataattgtgctggatctgaggtga

DBGET integrated database retrieval system