KEGG   Meleagris gallopavo (turkey): 100549846Help
Entry
100549846         CDS       T01523                                 

Gene name
ALAD
Definition
(RefSeq) aminolevulinate dehydratase
  KO
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100549846 (ALAD)
Enzymes [BR:mgp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     100549846 (ALAD)
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100549846 (ALAD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
19
AA seq 364 aa AA seqDB search
MQISRRSHANFAGLSRREAAAGSLLTTSPCIPKMQADSLLHSGYFHPVLRSWQCTATTFN
ASNLIYPIFVTDSPDAVEPIASLPGQARYGVNKLEGMLQPLVEDGLKCVLIFGVPSKVPK
DERGSAADAEDTPAIQAIRKICSTFPQLLIACDVCLCPYTSHGHCGILREDGTIQNEASC
QRLAEVALAYAQAGCHIVAPSDMMDGRIAAIKKALISNDMGNKVSVMSYSAKFASCFYGP
FRDAAQSKPAFGDRRCYQLPPGARGLALRAVDRDVREGADMLMVKPGMPYLDLVRDVKER
HPTHPLAVYHVSGEFAMLWHGAQAGAFSLRAAVMEAMAAFRRPPRLSAGPRLGLMPPKRR
WARG
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatcagcaggcggagccatgcaaatttcgctgggctctcgcggcgggaagcggcg
gcagggtctcttctcacaacatccccgtgcattcccaagatgcaggcagattcactcctt
cacagtggctacttccaccccgtgctgcgctcgtggcagtgcacagccaccaccttcaat
gcctccaaccttatctaccccatctttgtcactgacagccctgatgcagtggagccgatt
gccagcctccctggacaggccaggtatggagtcaacaagctggaggggatgctgcagccc
cttgttgaggatggtctgaagtgtgtcctcatcttcggggtgcccagcaaggtccccaag
gatgagagaggctctgctgcagatgcagaagacacacctgccatccaggccatcaggaag
atctgctccacgttcccacagctgctcattgcctgtgatgtctgcttgtgtccttacacc
tcccatgggcactgtggcatcctgcgggaagatggcaccatccagaatgaggccagttgc
cagcggctagcagaagtggcactggcttatgcccaagcaggctgtcacatcgttgccccc
tcggatatgatggatgggcgcattgcagccataaagaaggctctgatctccaacgacatg
ggcaacaaggtctcggtgatgagctacagtgccaagtttgcttcatgcttctatggaccc
ttcagggatgctgcacaatccaaacctgcctttggagatcggcgctgctaccagctgccc
ccaggtgcccgcggtctggcactgcgagctgtggaccgagacgtgcgtgagggcgcagac
atgctgatggtgaagcctgggatgccctacctggacctggtgcgggatgtgaaggagcgg
caccccacgcaccctctggccgtgtaccacgtctcgggagagttcgccatgctgtggcac
ggggcgcaggcgggcgccttcagcctgagggccgcggtcatggaggccatggccgccttc
cggcgtcccccccgcctcagcgcaggccccagattggggctgatgccccccaagcgccgg
tgggcccggggctga

DBGET integrated database retrieval system