KEGG   Meleagris gallopavo (turkey): 100549846Help
Entry
100549846         CDS       T01523                                 

Definition
delta-aminolevulinic acid dehydratase-like
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100549846
Enzymes [BR:mgp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     100549846
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100549846
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
19
AA seq 301 aa AA seqDB search
MQADSLLHSGYFHPVLRSWQCTATTFNASNLIYPIFVTDSPDAVEPIASLPGQARYGVNK
LEGMLQPLVEDGLKCVLIFGVPSKVPKDERGSAADAEDTPAIQAIRKICSTFPQLLIACD
VCLCPYTSHGHCGILREDGTIQNEASCQRLAEVALAYAQAGCHIVAPSDMMDGRIAAIKK
ALISNDMGNKVSVMSYSAKFASCFYGPFRDAAQSKPAFGDRRCYQLPPGARGLALRAVDR
DVREGADMLMVKPGMPYLDLVRDVKERHPTHPLAVYHVSGEFAMLWHGAQAGAFSLRAAV
M
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcagattcactccttcacagtggctacttccaccccgtgctgcgctcgtggcag
tgcacagccaccaccttcaatgcctccaaccttatctaccccatctttgtcactgacagc
cctgatgcagtggagccgattgccagcctccctggacaggccaggtatggagtcaacaag
ctggaggggatgctgcagccccttgttgaggatggtctgaagtgtgtcctcatcttcggg
gtgcccagtaaggtccccaaggatgagagaggctctgctgcagatgcagaagacacacct
gccatccaggccatcaggaagatctgctccacgttcccacagctgctcattgcctgtgat
gtctgcttgtgtccttacacctcccatgggcactgtggcatcctgcgggaagatggcacc
atccagaatgaggccagttgccagcggctagcagaagtggcactggcttatgcccaagca
ggctgtcacatcgttgccccctcggatatgatggatgggcgcattgcagccataaagaag
gctctgatctccaacgacatgggcaacaaggtctcggtgatgagctacagtgccaagttt
gcttcatgcttctatggacccttcagggatgctgcacaatccaaacctgcctttggagat
cggcgctgctaccagctgcccccaggtgcccgcggtctggcactgcgagctgtggaccga
gacgtgcgtgagggcgcagacatgctgatggtgaagcctgggatgccctacctggacctg
gtgcgggatgtgaaggagcggcaccccacgcaccctctggccgtgtaccacgtctcggga
gagttcgccatgctgtggcacggggcgcaggcgggcgccttcagcctgagggccgcggtc
atg

DBGET integrated database retrieval system