KEGG   Meleagris gallopavo (turkey): 100549898Help
Entry
100549898         CDS       T01523                                 

Gene name
RPTOR
Definition
(RefSeq) regulatory associated protein of MTOR, complex 1
  KO
K07204  
regulatory associated protein of mTOR
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mTOR signaling pathway
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    100549898 (RPTOR)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100549898 (RPTOR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
20
AA seq 1160 aa AA seqDB search
MGDGTGRDGTGWSGAERYAENGSGHDGARRGVPRSGPSPRAGRGYLAVKYTISVFCFCFL
PHRFCMQKSVRLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQ
KLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLP
TIIEEGTAFRHSPFFAEQLTAFQVWLTMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLG
RFLDLGPWAVSLALSVGIFPYVLKLLQSSARELRPLLVFIWAKILAVDSSCQADLVKDNG
HKYFLSVLADPYMPAEHRTMTAFILAVIVNNYNTGQEACLQGNLIAICLEQLNDPHPLLR
QWVAICLGRIWQNFDSARWCGVRDSAHEKLYSLLSDPIPEVRCAAVFALGTFVGNSAERT
DHSTTIDHNVAMMLAQLINDGSPMVRKELVVALSHLVVQYESNFCTVALQFMEEEKNYPL
PSPAAPEGGSLTPVRDGPCTPRLRSVSSYGNIRAVTTARNLNKSLQNLSLNEESGSSVAF
SPGNLSTSSSASSTLGSPENEEYILSFETIDKMRRVSSYSSLNSLIGVSFNSVYTQIWRV
LLHLAADPYPDVSDLAMKVLNSIAYKIMQVGLACRLKPQRLSNPGELVHATVNARPQRIL
DTSSLTQSAPASPTNKGMHIHQVGGSPPTTSTSSSSLTNDVTKQPVSRDITSVRPANVGN
MGVQYTPHSHQFPRTRKMFDKGPEQTTDDADDTVGHKSFISATVQTGFCDWSAKYFAQPV
MKIPEEHDLESQIRKEREWRFLRNARVRKQAQKIIQKGISRLDDQIFLNRNPGVPSVVKF
HPFTPCIAVADKDSICFWDWEKGEKLDYFHNGNPRYTRITAMEYLNGQDCSLLLTATDDG
AIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGLARRVSIYLDRSKQGGAGMVVDWEQET
GLLMTSGDVRIIRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVFDR
RMALSECRVMTYREHTAWVVKAYLQKHPEGNIMSVSVNGDVRFFDPRMPESMKVLQIVKG
LTALDIHPQANLFACGSMNQFTAIYNGNGELINNIKYYDGFMGQRVGAISCLAFHPHWPH
LAVGSNDYYISVYSVEKRIR
NT seq 3483 nt NT seq  +upstreamnt  +downstreamnt
atgggagatgggacgggacgggacgggacgggatggagcggagctgagcggtacgcggag
aacgggtcggggcacgatggggcacgacgaggcgttcccaggagcggcccctccccgcgg
gcgggccgtggctatcttgctgttaaatatacaattagtgtgttttgtttttgttttctc
ccccacaggttttgtatgcagaagagtgtcagactggtgccaggagtcacgctggatttg
atagagaagattcctggaagactgaatgacaggagaactcccctgggggagctgaactgg
atcttcacagccatcacagacaccattgcgtggaacgtgttgcctagagatctttttcag
aagctcttcaggcaagacttgctcgtggccagtttatttcgtaactttctcttggcagaa
agaattatgagatcctacaactgtaccccagtcagcagcccccgcctacccccaacgtac
atgcatgcaatgtggcaagcgtgggaccttgctgttgatatttgcctttcccaattacct
acaattatagaggaaggaactgcatttaggcacagccccttcttcgcagagcagctgact
gcattccaggtgtggctgacgatgggtgtggagaaccgcaaccccccggagcagctgccc
atcgtcctgcaggttctgctgagccaggtgcatcggctgcgagctctggatctgctggga
agatttctggacctggggccctgggcagttagcttggcgctgtctgttggcattttcccg
tatgtgctgaagctgcttcaaagttcagctcgtgagctgagaccgcttcttgtcttcatc
tgggccaaaattctcgcagtggacagttcatgtcaagctgaccttgtgaaggacaacggt
cacaagtatttcctttccgttttggcagatccttacatgccagctgaacacaggacaatg
accgcttttattctggctgtaattgttaacaactacaacacaggacaggaagcctgcctt
caaggaaacctgattgctatttgcctggaacagttgaacgatccgcatcctctcctgcgt
cagtgggtggccatttgtttagggcgtatttggcagaactttgactcagccaggtggtgt
ggtgtgagggacagcgctcatgaaaagctctacagtctcctctctgatccaatcccggag
gttcgctgtgctgccgtctttgcactgggaacatttgtgggcaactcggcagaacggacc
gaccactccaccaccatcgaccacaacgtggccatgatgctggcccagctcatcaacgat
gggagccccatggttcggaaggagctggtggtggctttaagtcacctggtggttcagtat
gagagcaatttctgcactgtcgccttgcagttcatggaagaagagaagaattaccccctg
ccttctccagctgccccagagggtgggagtttgacaccagtgcgagatggtccgtgcaca
cctcggctgcgctctgtcagctcttatgggaacatccgagcagttaccacagccaggaac
ctgaacaagtccttgcagaacctcagtctgaacgaagaatctggaagctctgttgcattt
tctcctgggaatctcagcaccagcagcagtgccagcagcaccttgggcagccctgagaac
gaagagtacatcctgtcgtttgagacgattgacaagatgagacgagtcagctcttactct
tctctgaattcactcataggtgtgagtttcaacagtgtttatacccaaatttggagagtg
ctccttcacctagctgctgatccctatcccgacgtctccgacttggcaatgaaagttctc
aacagcattgcctacaagattatgcaagtgggactggcctgcagactgaagccacaacgg
ctctccaatccaggtgaactagtacatgcaacagtcaatgctcgcccccagcgcatcctg
gacacgtcctcactgacacagtcagcacctgccagccccaccaacaagggcatgcacatc
caccaagtgggaggatcacctccaaccaccagcacaagcagctccagcctgacaaatgat
gtgacaaagcaaccggtcagccgggacatcacgtctgtgcgacctgccaacgtgggcaac
atgggggttcagtacactccccactcccaccagttccccagaacaagaaaaatgtttgac
aaagggccagagcagaccactgatgatgctgatgataccgttggacacaaaagtttcatt
tcagccacagtgcagacggggttttgtgactggagcgcgaagtactttgctcagcctgtc
atgaagatcccggaggagcacgacctggagagccagatccgcaaagagagggagtggagg
ttcctgcgcaacgcccgggtcaggaagcaagcccagaagatcattcagaagggcatctcc
cggctggacgatcagatcttcctcaacaggaaccccggcgtcccctctgtggtgaagttc
catcccttcacgccctgcattgccgtggccgacaaggacagtatctgtttctgggactgg
gagaaaggagagaaattggattatttccacaatgggaacccacggtacaccaggatcaca
gccatggagtacctgaacgggcaggactgctccttgctgctgactgccacagatgatggt
gccatcagagtatggaagaactttgcagacctggagaagaacccggagatggttacagcg
tggcaggggctgtcagacatgctgccaactacacgaggtctggcccgaagggtttcaatc
tatcttgacagaagtaagcagggaggagcaggaatggtggtcgactgggaacaagagact
gggctgctcatgacctcgggagatgtgaggataatccgcatctgggacacagaccgggaa
atgaaagtgcaggacatccccaccggggcagacagctgtgtgaccagcctgtcgtgcgac
tcccatcggtcgctgatcgtggcagggctgggtgacggctccatccgcgtgttcgaccgc
aggatggctctgagcgaatgccgtgtcatgacctacagagagcacacagcctgggtggtg
aaggcgtacctgcagaagcatcctgaaggcaacatcatgagcgtcagtgtgaacggagac
gtgcgcttcttcgacccccggatgccagagtccatgaaggtcctgcagatagtcaaaggg
ctgacggcccttgatattcacccacaagccaacctctttgcatgtggctcaatgaatcag
ttcactgcaatctacaatggaaacggtgagctgatcaacaatatcaaatactacgatggt
tttatgggacagagagtcggagccatcagctgcctggctttccatcctcactggcctcac
ctggcagtcgggagcaatgactactacatctcggtgtactcggtggagaagcggatcaga
taa

DBGET integrated database retrieval system