KEGG   Meleagris gallopavo (turkey): 100549898Help
Entry
100549898         CDS       T01523                                 

Definition
regulatory-associated protein of mTOR-like
Orthology
K07204  
regulatory associated protein of mTOR
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mTOR signaling pathway
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    100549898
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100549898
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
20
AA seq 1323 aa AA seqDB search
MATADESDLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSVALVLCLNVGVDP
PDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKK
LCTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKNYTQYIPLSIYDLQTWMGSPSIF
VYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNCIQLAACEANELL
PMIPDLPADLFTSCLTTPIKIALRWFCMQKSVRLVPGVTLDLIEKIPGRLNDRRTPLGEL
NWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPP
TYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWLTMGVENRNPPEQ
LPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQSSARELRPLLV
FIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILAVIVNNYNTGQEA
CLQGNLIAICLEQLNDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSAHEKLYSLLSDPI
PEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLINDGSPMVRKELVVALSHLVV
QYESNFCTVALQFMEEEKNYPLPSPAAPEGGSLTPVRDGPCTPRLRSVSSYGNIRAVTTA
RNLNKSLQNLSLNEESGSSVAFSPGNLSTSSSASSTLGSPENEEYILSFETIDKMRRVSS
YSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPDVSDLAMKVLNSIAYKATVNARPQRILD
TSSLTQSAPASPTNKGMHIHQVGGSPPTTSTSSSSLTNDVTKQPVSRDITSVRPANVGNM
GVQYTPHSHQFPRTRKMFDKGPEQTTDDADDTVGHKSFISATVQTGFCDWSAKYFAQPVM
KIPEEHDLESQIRKEREWRFLRNARVRKQAQKIIQKGISRLDDQIFLNRNPGVPSVVKFH
PFTPCIAVADKDSICFWDWEKGEKLDYFHNGNPRYTRITAMEYLNGQDCSLLLTATDDGA
IRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMTSGDVRIIRIWDT
DREMKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVFDRRMALSECRVMTYREHTA
WVVKAYLQKHPEGNIMSVSVNGDVRFFDPRMPESMKVLQIVKGLTALDIHPQANLFACGS
MNQFTAIYNGNGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSVEK
RIR
NT seq 3972 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgcggatgagtcggacctgacggactggaacctgcccctggccttcatgaag
aagaggcactgcgagaagatcgagggctccaagtccttggcgcagagctggaggatgaag
gacaggatgaagactgttagtgttgccttagttttgtgcctaaatgtcggcgtggaccct
cctgatgtggtgaagaccactccgtgtgcccgcctggagtgctggatagatcctctgtca
atgggtcctcagaaagctctggaaaccattggtgcgaatttgcagaagcagtatgaaaac
tggcagccacgagccaggtacaagcagagcctggatccgacggtggacgaggtgaagaag
ctgtgcacatccctgcggcgcaatgccaaggaggagcgggtgctgttccactacaatggg
cacggtgtgcccaggccgacggtgaacggggagatctgggtcttcaacaagaactatact
cagtatattcctctgtccatatacgacctgcagacttggatgggcagtccttccattttc
gtctatgattgctccaatgctggccttattgtcaagtcgttcaaacaatttgcactacag
agggagcaagagctggaggtggctgcaattaacccaaaccatcctcttgctcaaatgcct
ttgcctccatcgatgaagaactgcattcagttggcagcatgtgaagctaatgagttgctc
cctatgatccccgatctgccggccgaccttttcacatcatgccttactacgccaatcaaa
attgctctgagatggttttgtatgcagaagagtgtcagactggtgccaggagtcacgctg
gatttgatagagaagattcctggaagactgaatgacaggagaactcccctgggggagctg
aactggatcttcacagccatcacagacaccattgcgtggaacgtgttgcctagagatctt
tttcagaagctcttcaggcaagacttgctcgtggccagtttatttcgtaactttctcttg
gcagaaagaattatgagatcctacaactgtaccccagtcagcagcccccgcctaccccca
acgtacatgcatgcaatgtggcaagcgtgggaccttgctgttgatatttgcctttcccaa
ttacctacaattatagaggaaggaactgcatttaggcacagccccttcttcgcagagcag
ctgactgcattccaggtgtggctgacgatgggtgtggagaaccgcaaccccccggagcag
ctgcccatcgtcctgcaggttctgctgagccaggtgcatcggctgcgagctctggatctg
ctgggaagatttctggacctggggccctgggcagttagcttggcgctgtctgttggcatt
ttcccgtatgtgctgaagctgcttcaaagttcagctcgtgagctgagaccgcttcttgtc
ttcatctgggccaaaattctcgcagtggacagttcatgtcaagctgaccttgtgaaggac
aacggtcacaagtatttcctttccgttttggcagatccttacatgccagctgaacacagg
acaatgaccgcttttattctggctgtaattgttaacaactacaacacaggacaggaagcc
tgccttcaaggaaacctgattgctatttgcctggaacagttgaacgatccgcatcctctc
ctgcgtcagtgggtggccatttgtttagggcgtatttggcagaactttgactcagccagg
tggtgtggtgtgagggacagcgctcatgaaaagctctacagtctcctctctgatccaatc
ccggaggttcgctgtgctgccgtctttgcactgggaacatttgtgggcaactcggcagaa
cggaccgaccactccaccaccatcgaccacaacgtggccatgatgctggcccagctcatc
aacgatgggagccccatggttcggaaggagctggtggtggctttaagtcacctggtggtt
cagtatgagagcaatttctgcactgtcgccttgcagttcatggaagaagagaagaattac
cccctgccttctccagctgccccagagggtgggagtttgacaccagtgcgagatggtccg
tgcacacctcggctgcgctctgtcagctcttatgggaacatccgagcagttaccacagcc
aggaacctgaacaagtccttgcagaacctcagtctgaacgaagaatctggaagctctgtt
gcattttctcctgggaatctcagcaccagcagcagtgccagcagcaccttgggcagccct
gagaacgaagagtacatcctgtcgtttgagacgattgacaagatgagacgagtcagctct
tactcttctctgaattcactcataggtgtgagtttcaacagtgtttatacccaaatttgg
agagtgctccttcacctagctgctgatccctatcccgacgtctccgacttggcaatgaaa
gttctcaacagcattgcctacaaggcaacagtcaatgctcgcccccagcgcatcctggac
acgtcctcactgacacagtcagcacctgccagccccaccaacaagggcatgcacatccac
caagtgggaggatcacctccaaccaccagcacaagcagctccagcctgacaaatgatgtg
acaaagcaaccggtcagccgggacatcacgtctgtgcgacctgccaacgtgggcaacatg
ggggttcagtacactccccactcccaccagttccccagaacaagaaaaatgtttgacaaa
gggccagagcagaccactgatgatgctgatgataccgttggacacaaaagtttcatttca
gccacagtgcagacggggttttgtgactggagcgcgaagtactttgctcagcctgtcatg
aagatcccggaggagcacgacctggagagccagatccgcaaagagagggagtggaggttc
ctgcgcaacgcccgggtcaggaagcaagcccagaagatcattcagaagggcatctcccgg
ctggacgatcagatcttcctcaacaggaaccccggcgtcccctctgtggtgaagttccat
cccttcacgccctgcattgccgtggccgacaaggacagtatctgtttctgggactgggag
aaaggagagaaattggattatttccacaatgggaacccacggtacaccaggatcacagcc
atggagtacctgaacgggcaggactgctccttgctgctgactgccacagatgatggtgcc
atcagagtatggaagaactttgcagacctggagaagaacccggagatggttacagcgtgg
caggggctgtcagacatgctgccaactacacgaggagcaggaatggtggtcgactgggaa
caagagactgggctgctcatgacctcgggagatgtgaggataatccgcatctgggacaca
gaccgggaaatgaaagtgcaggacatccccaccggggcagacagctgtgtgaccagcctg
tcgtgcgactcccatcggtcgctgatcgtggcagggctgggtgacggctccatccgcgtg
ttcgaccgcaggatggctctgagcgaatgccgtgtcatgacctacagagagcacacagcc
tgggtggtgaaggcgtacctgcagaagcatcctgaaggcaacatcatgagcgtcagtgtg
aacggagacgtgcgcttcttcgacccccggatgccagagtccatgaaggtcctgcagata
gtcaaagggctgacggcccttgatattcacccacaagccaacctctttgcatgtggctca
atgaatcagttcactgcaatctacaatggaaacggtgagctgatcaacaatatcaaatac
tacgatggttttatgggacagagagtcggagccatcagctgcctggctttccatcctcac
tggcctcacctggcagtcgggagcaatgactactacatctcggtgtactcggtggagaag
cggatcagataa

  All links  
No link information was found.   
DBGET integrated database retrieval system