KEGG   Meleagris gallopavo (turkey): 100549908Help
Entry
100549908         CDS       T01523                                 

Definition
cyclin-H-like
Orthology
K06634  
cyclin H
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Basal transcription factors
Nucleotide excision repair
Cell cycle
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    100549908
  Replication and repair
   03420 Nucleotide excision repair
    100549908
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100549908
Transcription machinery [BR:mgp03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100549908
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Z
AA seq 149 aa AA seqDB search
VQQGDSFLLEAHEELAICKYYEKRLLDFCAVFKPAMPRSVVGTACMYFKRFYLNNSVMEY
HPRIIMLTCAFLACKVDEFNVSSTQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLI
VHNPYRPFEGILIDLKTRYPLLENPEVLR
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
gtacagcagggtgactctttcctgctggaggcccacgaggagctggcgatatgcaagtac
tacgagaagaggctgctggatttctgtgccgtcttcaagcctgccatgccgcggtctgtg
gtgggaacggcttgcatgtatttcaaacgtttttatctcaataactcagtgatggagtat
catcctcggataataatgctaacgtgtgcatttttagcctgtaaagtagatgaatttaat
gtgtccagcacacagtttgttggtaaccttcgagaaagccctcttgggcaagaaaaagct
cttgaacagatactggaatatgaactactgctaattcagcagttgaacttccatcttatt
gtacacaatccatacaggccatttgagggaattctaattgatttgaagactcggtaccca
ttgctggaaaaccctgaagttttaagg

DBGET integrated database retrieval system