KEGG   Meleagris gallopavo (turkey): 100549908Help
Entry
100549908         CDS       T01523                                 

Gene name
CCNH
Definition
(RefSeq) cyclin H
  KO
K06634  
cyclin H
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Basal transcription factors
Nucleotide excision repair
Cell cycle
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    100549908 (CCNH)
  Replication and repair
   03420 Nucleotide excision repair
    100549908 (CCNH)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100549908 (CCNH)
Transcription machinery [BR:mgp03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100549908 (CCNH)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     100549908 (CCNH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Z
AA seq 347 aa AA seqDB search
MHLYTKGAIQTSYSEWDHMSLTHHDREFVQIFNAKNGDTGDPCKQNKRGGGSGPGLIRSA
SFPQVQQGDSFLLEAHEELAICKYYEKRLLDFCAVFKPAMPRSVVGTACMYFKRFYLNNS
VMEYHPRIIMLTCAFLACKVDEFNVSSTQFVGNLRESPLGQEKALEQILEYELLLIQQLN
FHLIVHNPYRPFEGILIDLKTRYPLLENPEVLRRTADDFLNRVALTDAYLLFTPSQIALA
AIVSSASRAGINIESYLSECFMLKENRTFLTKILDGMRSMKNLIKKYELPRPEEVAALKQ
KLEKCHSPELSLNANVKKRKIDEDGEYNSKKPKMDEEEWTDEDLADL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcatctgtatacaaagggtgcaattcaaacctcttattctgaatgggatcatatgagt
ttaacccatcatgatcgagaattcgtccagatcttcaatgcaaagaatggtgatacaggt
gacccttgtaagcagaataaaagggggggcggctccgggccggggctcatcagatcggcg
tctttcccccaggtacagcagggtgactctttcctgctggaggcccacgaggagctggcg
atatgcaagtactacgagaagaggctgctggatttctgtgccgtcttcaagcctgccatg
ccgcggtctgtggtgggaacggcttgcatgtatttcaaacgtttttatctcaataactca
gtgatggagtatcatcctcggataataatgctaacgtgtgcatttttagcctgtaaagta
gatgaatttaatgtgtccagcacacagtttgttggtaaccttcgagaaagccctcttggg
caagaaaaagctcttgaacagatactggaatatgaactactgctaattcagcagttgaac
ttccatcttattgtacacaatccatacaggccatttgagggaattctaattgatttgaag
actcggtacccattgctggaaaaccctgaagttttaaggagaacagctgatgatttcctc
aatcgagtggctctgacagatgcatatctcctcttcactccctcacagatagctcttgct
gctatagtatctagtgcttcaagagcaggaattaatatagaaagttatttatcagagtgt
tttatgctgaaagaaaacagaacattcttgaccaaaatactggatggcatgagaagcatg
aaaaatcttataaagaagtacgaacttccaagacctgaagaagttgcagctctaaaacag
aagttagagaagtgtcacagtccagagctttcacttaacgctaacgtgaagaagaggaaa
attgatgaagatggtgaatataattcaaaaaagcctaaaatggatgaggaagaatggact
gatgaagaccttgcagacttgtga

DBGET integrated database retrieval system