KEGG   Meleagris gallopavo (turkey): 100549944Help
Entry
100549944         CDS       T01523                                 

Gene name
SLC9A3R2
Definition
(RefSeq) SLC9A3 regulator 2
  KO
K13358  
Na(+)/H(+) exchange regulatory cofactor NHE-RF2
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Transporters [BR:mgp02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   100549944 (SLC9A3R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
16
AA seq 199 aa AA seqDB search
QDLNGQKELCPRLCHLKKGPNGYGFNLHSEKSRPGQFIRSVDPDSPASRAGLRPQDRLVE
VNGINVEGLRHSEVVSHIKARESEARLLVVDPETDEYFKKLGVTPTEEHTKGVVPQPMTN
GSAQMQLNGGSTSSSHSDLQSPGKESEDGDSEKRDPFEESGLSLSPTAAEAKEKVRAKRV
KKRAPQMDWNKKREIFSNF
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
caggatttaaacggacagaaagagctgtgtccacgcctctgccacctgaagaaaggcccc
aatggttatggcttcaacctgcacagtgagaagtcccgcccagggcagttcatccgctcg
gttgaccccgactcaccagcatccagagcaggcctgcggccccaggaccgcctggtggag
gtgaatgggataaacgtggaggggctgcggcactcagaagtggtgtctcatatcaaagcc
agagagagcgaagccaggttgttggtggtggaccctgagacagatgagtacttcaagaag
ctgggggtgacccccaccgaggagcacaccaaaggtgtggtgcctcagcccatgacgaat
ggatctgcacagatgcagctgaatggaggatccacgtcttcatctcacagtgaccttcaa
agtcctgggaaggaatccgaggatggagattcagagaagagggacccgtttgaggagagt
gggctgagcctgagccccacggcagctgaggccaaggagaaggtgagggccaagagggtg
aagaagagggctccgcagatggactggaacaagaagagggagatcttcagcaatttctga

DBGET integrated database retrieval system