KEGG   Meleagris gallopavo (turkey): 100549944Help
Entry
100549944         CDS       T01523                                 

Gene name
SLC9A3R2
Definition
solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3 regulator 2
Orthology
K13358  
Na(+)/H(+) exchange regulatory cofactor NHE-RF2
Organism
mgp  Meleagris gallopavo (turkey)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 200 aa AA seqDB search
NQDLNGQKELCPRLCHLKKGPNGYGFNLHSEKSRPGQFIRSVDPDSPASRAGLRPQDRLV
EVNGINVEGLRHSEVVSHIKARESEARLLVVDPETDEYFKKLGVTPTEEHTKGVVPQPMT
NGSAQMQLNGGSTSSSHSDLQSPGKESEDGDSEKRDPFEESGLSLSPTAAEAKEKVRAKR
VKKRAPQMDWNKKREIFSNF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
aatcaggatttaaacggacagaaagagctgtgtccacgcctctgccacctgaagaaaggc
cccaatggttatggcttcaacctgcacagtgagaagtcccgcccagggcagttcatccgc
tcggttgaccccgactcaccagcatccagagcaggcctgcggccccaggaccgcctggtg
gaggtgaatgggataaacgtggaggggctgcggcactcagaagtggtgtctcatatcaaa
gccagagagagcgaagccaggttgttggtggtggaccctgagacagatgagtacttcaag
aagctgggggtgacccccaccgaggagcacaccaaaggtgtggtgcctcagcccatgacg
aatggatctgcacagatgcagctgaatggaggatccacgtcttcatctcacagtgacctt
caaagtcctgggaaggaatccgaggatggagattcagagaagagggacccgtttgaggag
agtgggctgagcctgagccccacggcagctgaggccaaggagaaggtgagggccaagagg
gtgaagaagagggctccgcagatggactggaacaagaagagggagatcttcagcaatttc
tga

DBGET integrated database retrieval system