KEGG   Meleagris gallopavo (turkey): 100549944Help
Entry
100549944         CDS       T01523                                 

Definition
Na(+)/H(+) exchange regulatory cofactor NHE-RF2-like
Orthology
K13358  
Na(+)/H(+) exchange regulatory cofactor NHE-RF2
Organism
mgp  Meleagris gallopavo (turkey)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 292 aa AA seqDB search
MGGRKKPQVVQRIKAVETETRLLVVDKETDEYLCSLRLTCTEEMAHSGILLGSSISPSKS
VGSDNGEVWKPQLELSTGSLQRHSHSFSSHGSRKDLNGQKELCPRLCHLKKGPNGYGFNL
HSEKSRPGQFIRSVDPDSPASRAGLRPQDRLVEVNGINVEGLRHSEVVSHIKARESEARL
LVVDPETDEYFKKLGVTPTEEHTKGVVPQPMTNGSAQMQLNGGSTSSSHSDLQSPGKESE
DGDSEKRDPFEESGLSLSPTAAEAKEKVRAKRVKKRAPQMDWNKKREIFSNF
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgggggggagaaagaagccccaggtggtgcagcgcatcaaagcagtggagacagagacc
cgtctgctggtggtggacaaagagacagatgagtacctgtgcagcctgcgcctgacatgc
acagaggaaatggcacacagtgggatcctgctgggctccagcatttcgccttccaagtca
gtgggcagcgacaacggggaggtgtggaagccacagctggagctgagcacgggcagcctg
cagcgacactcacacagcttctcctcacacggcagcaggaaggatttaaacggacagaaa
gagctgtgtccacgcctctgccacctgaagaaaggccccaatggttatggcttcaacctg
cacagtgagaagtcccgcccagggcagttcatccgctcggttgaccccgactcaccagca
tccagagcaggcctgcggccccaggaccgcctggtggaggtgaatgggataaacgtggag
gggctgcggcactcagaagtggtgtctcatatcaaagccagagagagcgaagccaggttg
ttggtggtggaccctgagacagatgagtacttcaagaagctgggggtgacccccaccgag
gagcacaccaaaggtgtggtgcctcagcccatgacgaatggatctgcacagatgcagctg
aatggaggatccacgtcttcatctcacagtgaccttcaaagtcctgggaaggaatccgag
gatggagattcagagaagagggacccgtttgaggagagtgggctgagcctgagccccacg
gcagctgaggccaaggagaaggtgagggccaagagggtgaagaagagggctccgcagatg
gactggaacaagaagagggagatcttcagcaatttctga

DBGET integrated database retrieval system