KEGG   Meleagris gallopavo (turkey): 100549969Help
Entry
100549969         CDS       T01523                                 

Definition
ubiquitin carboxyl-terminal hydrolase 45-like
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
mgp  Meleagris gallopavo (turkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 684 aa AA seqDB search
MAGFSPCYLLAAVKGRYDAAVGGCNRKAHAGAGSLVSLFAVVVLEHLQWILDKQDLLKER
QKDLKFLTEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVL
MAPTCVFLASKVEEFGVVSNTRLISAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLEL
MRIQTGILKAFNNPTTKTADEETRRKVKAYGREGVKMNFIDRIFVGELTSTVMCEECENI
STVKEPFIDLSLPIIEERVAKPVPLGRTNKSKSVHEADLGQYTCSSISTLNNQPKIVKKH
ASTKDKNQLNQERRLARKASSNEEERSPVIIQERSKKPELEDSSSVLYSKDTTVESAMNG
SQTEGSEKEASRSESSFDADSEASESESASKQTAVSSCSNTSALHVNHINVKMPHTKPSD
SNDEKISSAISKLSFCDTINEDEKSSFGDPGLSNNSMFSADKSSLSSNPQNAFQTLSQSY
ITSSKECSVQSCLYQFTSVELLMGNNKLLCESCTERKQKYQKKSNSSEKKMEGVYTNARK
QLLISSVPAILILHLKRFHQAGLSLRKVNRHVDFPLILDLAPFCSASCKNVTDGARVLYS
LYGIVEHSGSMRGGHYAAYVKVRTPSKKLLEHISSTKNVLGLKEAMGASAGQWVYVSDAH
VQMVPESRVLNAQAYLLFYERLLI
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcttctctccgtgctatctcctggctgctgtgaaaggtaggtatgatgcagct
gtaggtggctgcaatcgaaaggcgcatgctggtgctggcagtctggtttccctctttgca
gttgtggtgctggaacatttacaatggattttggataaacaagatctattgaaggaacgc
caaaaagacttgaaatttctgactgaagaagaatattggaagctacaaatattttttact
aatgttatccaggctttaggtgaacatcttaaattaagacaacaagttattgccactgct
acagtctacttcaagagattctatgccagatattccctaaaaagtatagatccagtatta
atggctcctacgtgtgtgtttttggcatccaaagtagaggagtttggtgttgtttcaaat
acaaggttgatttctgctgctacttctgtgttgaaaactaggttttcatatgccttcccg
aaggagtttccttataggatgaaccatatactagaatgtgaattctatctcttagaatta
atgcgtatacaaactggtatcttaaaagcatttaataatccaacaactaagacagcagat
gaagaaactagaagaaaagtcaaagcatatggaagagagggtgtgaagatgaacttcata
gataggatctttgttggtgaattgactagcactgtcatgtgtgaggaatgtgaaaatatt
tcaacagtaaaagaacctttcattgatctttcacttcctataatagaggagagggttgca
aaacctgtgcctttgggaagaacaaataaaagtaaaagtgtgcatgaagcagatctcgga
cagtatacctgttcttccatcagtacactgaataatcagcccaaaattgtcaagaaacat
gcttcaacaaaagataagaatcagttgaaccaggagagaaggcttgccagaaaagcttcc
tctaatgaagaagaaagaagccctgttatcattcaggaaagatccaaaaagccagagctg
gaagatagctctagtgtgctgtactccaaagacacaactgtggaatctgccatgaatggg
agtcagacagagggcagcgagaaggaagccagccgctctgaaagtagctttgatgcagac
agtgaagcctctgaaagtgaaagtgcttctaagcaaacagctgttagctcatgcagcaac
acatctgctttgcatgtcaaccacatcaatgttaaaatgccacacaccaaaccaagtgac
agtaacgatgagaagatttccagtgccatatccaaactcagtttctgtgatactataaac
gaagatgaaaagtcaagctttggtgatccaggtttatcgaataattccatgttctcagca
gacaagtcctcgttgtcctcaaaccctcaaaacgcttttcagacgctttcccagagctat
ataactagctccaaggagtgttctgtccagtcctgcctttaccaatttacctctgtagag
ctgttaatgggaaacaacaagcttttgtgtgagagctgcacagaaaggaaacagaagtat
cagaagaaatccaactcctcagaaaagaaaatggaaggtgtctacacgaatgctcggaaa
cagctactgatttcttcggttcctgctattcttattctccatctgaaaagattccaccag
gctggtttgagtctacggaaagtaaacaggcacgtggatttcccactgattttagaccta
gcaccattttgttctgcttcttgtaagaacgttacagatggcgcaagagtgctgtacagc
ctttatggaatagtggagcacagtgggtcaatgagaggcggtcattatgcggcttatgtg
aaagtcagaacgccctccaagaaattactggagcatatttcctccacaaaaaacgtgcta
ggtttaaaagaagccatgggagcatcagcaggacagtgggtgtatgttagcgatgcccac
gttcagatggttccagaatcacgagtactaaatgcacaagcatatctgcttttttatgaa
agattactgatataa

DBGET integrated database retrieval system