KEGG   Meleagris gallopavo (turkey): 100550109Help
Entry
100550109         CDS       T01523                                 

Definition
NAD-dependent deacetylase sirtuin-6-like
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100550109
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
30
AA seq 357 aa AA seqDB search
MAVNYAAGLSPYSDKGKCGLPEIFDPPEELERKVCELADLIRSSSNVVFHTGAGISTASG
IPDFRGPNGVWTMEEKGLSPKFDTTFENAKPSKTHMALLGLQRVGILKFLVSQNVDGLHV
RSGFPRDKLAELHGNMFVEECMKCGKQYVRDAVVGSMGLKPTGRLCSVTKARGLRACRGK
LRDTILDWEDSLPDRDLTLADEACRKADLSVTLGTSLQIKPSGNLPLITKKRGGKLVIVN
LQATKHDRQADLRIHAYVDDVMTKLMKHLGLEVPEWTGPVVVESADSAKPEQLYTFKPEV
HGLLKEEPFSQHNGTAGQCPDLGTTLVEHHDSLKQECPSLDTGPPLTKKMKVEPLLT
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgaattacgcggccgggctctcgccctactcggataagggcaagtgcggcctc
cccgagatttttgatccaccagaagagctggagaggaaggtgtgtgagctggcagacttg
ataaggagttcttccaatgtggtgttccacacaggagctggcatcagcaccgcctcgggg
attcctgacttcagggggcctaatggtgtctggactatggaagagaaggggctttcccca
aaatttgacaccacctttgagaatgccaagccctccaaaactcacatggcacttctgggg
ctgcagagagttggcatcctgaaattcctggtcagccagaacgtggatggccttcatgtg
cgctcaggattcccacgggacaagttggctgagctccacgggaacatgtttgtggaggag
tgcatgaaatgtggcaagcagtacgtgcgggatgctgttgtgggcagcatggggctgaag
ccaacaggcaggctgtgcagcgtcaccaaagcacgagggctacgagcctgcagagggaag
ttaagagacactattctggactgggaagattccctgcctgaccgtgacctcacactagca
gatgaagcctgcaggaaagctgatctctctgttacactggggacctctctgcagatcaaa
cccagtggcaacctcccactgatcacaaagaagagaggagggaagctggtcatagtcaac
ctgcaagcaaccaagcatgacagacaggccgacctgcgcattcatgcttacgtcgatgat
gtcatgacaaaactgatgaagcacctgggactggaagtcccagagtggacagggccagtg
gtggtggaaagtgctgactctgccaagcctgaacagctctacacatttaagcctgaggtt
cacgggttgctcaaggaagaacccttttcccagcacaatggaacagctgggcagtgcccc
gaccttgggaccacgctggtggagcaccatgatagtctgaagcaggagtgtccaagtctg
gacacaggaccaccactgacaaagaagatgaaggtagagcctctcctcacctga

DBGET integrated database retrieval system