KEGG   Meleagris gallopavo (turkey): 100550114Help
Entry
100550114         CDS       T01523                                 

Definition
Josephin-1-like
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100550114
Peptidases [BR:mgp01002]
 Cysteine Peptidases
  Family C86
   100550114
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 202 aa AA seqDB search
MSCVPWKGDKAKSESPEPPQQPPLHIYHEKQRRELCALHALNNVFQDSNAFTRETLQEIF
QRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVNVIALSNVMGFIM
NLPSSLCWGPLKLPLKRQHWICVREVGGTYYNLDSKLKMPEWIGGESELRKFLKHQLRGK
NCELLLVVPEEVEAHQSWRADV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagttgcgtgccatggaaaggtgacaaggccaaatcggagtcccctgagccgcctcag
cagccaccgctacatatttaccacgagaagcagcgcagggagctgtgtgccctccatgcc
ctcaacaatgtcttccaggacagcaacgccttcactagggaaaccctgcaggagattttt
cagaggctgtctcccaacaccatggtgacgccacacaaaaagagcatgctggggaatggc
aactatgacgtgaacgtgatcatggcagcgcttcagaccaaaggatatgaggcagtttgg
tgggacaagcgcagggatgttaatgtcattgccctgtctaatgtgatgggcttcatcatg
aatctaccctccagcctttgctggggtcccttgaagctccccctcaagcggcagcactgg
atctgtgtccgggaggtgggaggcacttactataacctcgactccaaactcaagatgcct
gagtggattggaggtgaaagtgagctcaggaaatttttgaaacaccagctaagaggaaag
aactgtgaactcctgctggtggtgccagaggaggtggaagcacatcagagctggagagct
gacgtgtga

DBGET integrated database retrieval system