KEGG   Meleagris gallopavo (turkey): 100550114Help
Entry
100550114         CDS       T01523                                 

Gene name
JOSD1
Definition
(RefSeq) Josephin domain containing 1
  KO
K15235  josephin [EC:3.4.19.12]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100550114 (JOSD1)
Peptidases [BR:mgp01002]
 Cysteine Peptidases
  Family C86
   100550114 (JOSD1)
Ubiquitin system [BR:mgp04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   MJD
    100550114 (JOSD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Josephin AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 100550114
NCBI-ProteinID: XP_010709220
Ensembl: ENSMGAG00000012410
UniProt: G1NIH2
Position
1
AA seq 202 aa AA seqDB search
MSCVPWKGDKAKSESPEPPQQPPLHIYHEKQRRELCALHALNNVFQDSNAFTRETLQEIF
QRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVNVIALSNVMGFIM
NLPSSLCWGPLKLPLKRQHWICVREVGGTYYNLDSKLKMPEWIGGESELRKFLKHQLRGK
NCELLLVVPEEVEAHQSWRADV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagttgcgtgccatggaaaggtgacaaggccaaatcggagtcccctgagccgcctcag
cagccaccgctacatatttaccacgagaagcagcgcagggagctgtgtgccctccatgcc
ctcaacaatgtcttccaggacagcaacgccttcactagggaaaccctgcaggagattttt
cagaggctgtctcccaacaccatggtgacgccacacaaaaagagcatgctggggaatggc
aactatgacgtgaacgtgatcatggcagcgcttcagaccaaaggatatgaggcagtttgg
tgggacaagcgcagggatgttaatgtcattgccctgtctaacgtgatgggcttcatcatg
aatctgccctccagcctttgctggggtcccttgaagctccccctcaagcggcagcactgg
atctgtgtccgggaggtgggaggcacttactataacctcgactccaaactcaagatgcct
gagtggattggaggtgaaagtgagctcaggaaatttttgaaacaccagctaagaggaaag
aactgtgaactcctgctggtggtgccagaggaggtggaagcacatcagagctggagagct
gacgtgtga

DBGET integrated database retrieval system