KEGG   Meleagris gallopavo (turkey): 100550244Help
Entry
100550244         CDS       T01523                                 

Gene name
MGEA5
Definition
(RefSeq) meningioma expressed antigen 5 (hyaluronidase)
  KO
K15719  
protein O-GlcNAcase / histone acetyltransferase [EC:3.2.1.169 2.3.1.48]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100550244 (MGEA5)
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.169  protein O-GlcNAcase
     100550244 (MGEA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
8
AA seq 910 aa AA seqDB search
MCFLAPSTTLFISQPCSWAGEQETDTETETALDSRRFLCGVVEGFYGRPWVMEQRKELFR
RLQKWGLNTYLYAPKDDYKHRMFWREMYSVEEAEQLMTLISAAREHEIEFIYAISPGLDI
TFSNPKEVSTLKRKLDQVSQFGCRSFALLFDDIDHNMCAADKEVFSSFAHAQVSITNEIY
QYLGEPDTFLFCPTEYCGTFCYPNVAQSPYLRTVGEKLLPGIDVLWTGPKVVSKDIPVES
IEEVSKIIRRAPVIWDNIHANDYDQKRLFLGPYKGRSTELIPRLKGVLTNPNCEFEANYV
AIHTLATWYKSNMNGVRKDVVMTDTEDSTVSIQIKLENEGSDEDIETDVLYSPQMALKLA
LTEWLQEFGVPQQYSSRQVAHSGAKTAVGDVGPLVAPSSLNAATVVTTVYQEPIMSQGAA
LSSEPPALVKEEEKKQSDEEPMDMVVEKQDDADKNANQILTDIAEAKMTEELKPMDTDKE
SIAESKSPEMSMQEDSGSDIAPMQTDEQINKEQFVPGPNEKPLYAVEPVTLEDLQLLADL
FYLPYEHGPKGAQMLREFQWLRANSSVVSVNCKGKDAEKIEEWRNRAAKFEEMCSLVMGM
FTRLSNCANRTILYDMYSYVWDIKSIMSMVKSFVQWLDGRIFSTSFYCYWMDSARWCRSQ
SSAQFLSGDQEPWAFRGGLAGEFQRLLPIDGANDLFFQPPPLTPTSKVYTIRPYFPKDEA
SVYKICREMYADGADQPFHSLPDLIGDKLVGGLLTLSLDYCFVLEDEDGICGYALGTVDV
TPFIKKCKMSWIPFMQEKYTKPNSDKELSEAEKIMLSFHEEQEVLPESFLANFPSLIKID
IHKKVTDPSVAKSMMACLLSSLKANGSRGAFCEVRPDDKRILEFYSKLGCFEIAKMEGFP
KDVVILGRSL
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atgtgttttttagctccgtccaccacactgttcatctcacagccctgttcctgggcggga
gagcaggaaaccgacacggagacggagacggcgctggactcccgccgcttcctctgcggc
gtggtggaaggcttttatggaagaccttgggttatggagcagaggaaagaactttttaga
aggcttcagaagtggggactgaatacatacctgtatgctccaaaggacgactacaagcac
aggatgttctggcgggaaatgtactctgtggaagaagcagagcagctaatgactctgata
tcagctgcacgtgaacatgaaatagagttcatctatgcaatctcacctggacttgacatc
actttctcaaatcccaaagaagtatccacactgaagcgcaagctggaccaggtttcccag
tttggctgcagatcttttgccctgctgtttgatgatattgaccacaacatgtgtgcagct
gacaaagaagtgtttagttcctttgctcatgctcaagtatccataacaaatgaaatttac
caatatctaggagaaccagacacattccttttctgtcctacagaatactgtggaactttc
tgttacccaaatgttgctcagtctccatatttacgaactgtaggagaaaaactgcttcct
ggcatcgatgtgttatggacaggtccgaaagttgtatccaaagacattccagtagagtcc
attgaagaagtttctaagatcatcaggagagcaccagttatttgggacaacattcatgct
aatgattatgatcaaaagaggctttttcttggaccttacaaaggtcggtcaactgagctc
atccctcgactaaagggagttttgaccaatccaaactgtgaatttgaagccaattatgtt
gctattcacacacttgcaacctggtacaagtctaacatgaatggagtgagaaaagatgtg
gtgatgactgatactgaagacagtacagtttctatccagattaaactggaaaacgagggg
agcgatgaagatattgaaacagatgttctctacagcccacaaatggccctgaagttggcc
ttaactgaatggcttcaggagtttggagtacctcagcaatacagcagtaggcaagtggcc
cacagtggagctaaaactgcagtgggggacgtagggcctctggtggcaccatcatcttta
aatgcagcaactgtggttaccacagtttaccaggaacccatcatgagtcaaggcgcagca
ctgagcagcgagccaccagccttggtaaaggaggaagagaagaagcaatctgatgaggag
ccgatggacatggtggtagaaaaacaagacgatgctgacaagaatgctaatcagatactg
acagatattgctgaagcgaagatgacagaggagttgaagccaatggatactgataaggag
agcatagctgaatcaaagtccccggagatgtctatgcaggaggactctggtagtgatatt
gcccctatgcagactgatgaacaaattaacaaagaacagtttgtgcctgggccaaatgaa
aaaccactctacgcagtagaaccagtgactttagaggacttgcagcttcttgctgacttg
ttttatctcccgtatgaacacgggcccaaaggtgcacagatgctgagagaattccagtgg
cttagagcaaatagcagtgttgtcagtgttaactgcaaaggaaaggatgctgaaaaaata
gaagaatggcgtaaccgagcagctaagtttgaagagatgtgcagcttggtgatgggaatg
ttcactcgcctctccaattgtgccaacagaacaatcctttatgatatgtactcctacgtc
tgggatatcaagagtattatgtcaatggtgaaatcttttgtgcaatggttagatgggaga
atcttcagcacaagtttctactgctattggatggacagcgccagatggtgtcgtagtcaa
tcttcagcacagttcttaagtggagaccaagaaccctgggcctttagaggtggtctagca
ggagagttccagcgtttgctgccaattgatggggcaaatgacctcttttttcaaccgcct
ccattaacgcccacttccaaggtgtacaccataagaccctacttccccaaagatgaggcg
tctgtatataagatctgcagagaaatgtacgctgatggagctgatcaacctttccacagc
ttaccagacttaattggagacaagttagtaggaggtctgctcaccctcagcctggattac
tgctttgtcttggaagatgaggatggcatatgtggctatgctttgggaacagttgatgtg
actcctttcattaagaagtgcaaaatgtcttggatccctttcatgcaagagaaatatact
aaaccaaatagtgacaaggagctgtctgaggcagagaaaataatgctaagcttccatgaa
gaacaagaagtgttgccagaatcattccttgccaacttcccatcattgataaagatcgat
atccacaaaaaagtgacagatccaagtgtggccaaaagcatgatggcctgcctgctctct
tctctaaaggctaatggctcccgtggggctttttgtgaagtgaggccagatgataaaaga
attctggaattctacagcaagctgggctgtttcgaaattgctaaaatggaaggatttcca
aaggatgttgttatccttggaagaagcctttga

DBGET integrated database retrieval system