KEGG   Meleagris gallopavo (turkey): 100550244Help
Entry
100550244         CDS       T01523                                 

Definition
bifunctional protein NCOAT-like
Orthology
K15719  
protein O-GlcNAcase / histone acetyltransferase [EC:3.2.1.169 2.3.1.48]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100550244
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.169  protein O-GlcNAcase
     100550244
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
8
AA seq 870 aa AA seqDB search
MHSENVRNLQSTEHTVLRVIRCFYGRPWVMEQRKELFRRLQKWGLNTYLYAPKDDYKHRM
FWREMYSVEEAEQLMTLISAAREHEIEFIYAISPGLDITFSNPKEVSTLKRKLDQVSQFG
CRSFALLFDDIDHNMCAADKEVFSSFAHAQVSITNEIYQYLGEPDTFLFCPTEYCGTFCY
PNVAQSPYLRTVGEKLLPGIDVLWTGPKVVSKDIPVESIEEVSKIIRRAPVIWDNIHAND
YDQKRLFLGPYKGRSTELIPRLKGVLTNPNCEFEANYVAIHTLATWYKSNMNGVRKDVVM
TDTEDSTVSIQIKLENEGSDEDIETDVLYSPQMALKLALTEWLQEFGVPQQYSSRQVAHS
GAKTAVGDVGPLVAPSSLNAATVVTTVYQEPIMSQGAALSSEPPALVKEEEKKQSDEEPM
DMVVEKQDDADKNANQILTDIAEAKMTEELKPMDTDKESIAESKSPEMSMQEDSGSDIAP
MQTDEQINKEQFVPGPNEKPLYAVEPVTLEDLQLLADLFYLPYEHGPKGAQMLREFQWLR
ANSSVVSVNCKGKDAEKIEEWRNRAAKFEEMCSLVMGMFTRLSNCANRTILYDMYSYVWD
IKSIMSMVKSFVQWLGCRSQSSAQFLSGDQEPWAFRGGLAGEFQRLLPIDGANDLFFQPP
PLTPTSKVYTIRPYFPKDEASVYKICREMYADGADQPFHSLPDLIGDKLVGGLLTLSLDY
CFVLEDEDGICGYALGTVDVTPFIKKCKMSWIPFMQEKYTKPNSDKELSEAEKIMLSFHE
EQEVLPESFLANFPSLIKIDIHKKVTDPSVAKSMMACLLSSLKANGSRGAFCEVRPDDKR
ILEFYSKLGCFEIAKMEGFPKDVVILGRSL
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atgcactcagagaatgtgaggaacttacagtccactgaacacaccgttttgagagtaatc
agatgcttttatggaagaccttgggttatggagcagaggaaagaactttttagaaggctt
cagaagtggggactgaatacatacctgtatgctccaaaggacgactacaagcacaggatg
ttctggcgggaaatgtactctgtggaagaagcagagcagctaatgactctgatatcagct
gcacgtgaacatgaaatagagttcatctatgcaatctcacctggacttgacatcactttc
tcaaatcccaaagaagtatccacactgaagcgcaagctggaccaggtttcccagtttggc
tgcagatcttttgccctgctgtttgatgatattgaccacaacatgtgtgcagctgacaaa
gaagtgtttagttcctttgctcatgctcaagtatccataacaaatgaaatttaccaatat
ctaggagaaccagacacattccttttctgtcctacagaatactgtggaactttctgttac
ccaaatgttgctcagtctccatatttacgaactgtaggagaaaaactgcttcctggcatc
gatgtgttatggacaggtccgaaagttgtatccaaagacattccagtagagtccattgaa
gaagtttctaagatcatcaggagagcaccagttatttgggacaacattcatgctaatgat
tatgatcaaaagaggctttttcttggaccttacaaaggtcggtcaactgagctcatccct
cgactaaagggagttttgaccaatccaaactgtgaatttgaagccaattatgttgctatt
cacacacttgcaacctggtacaagtctaacatgaatggagtgagaaaagatgtggtgatg
actgatactgaagacagtacagtttctatccagattaaactggaaaacgaggggagcgat
gaagatattgaaacagatgttctctacagcccacaaatggccctgaagttggccttaact
gaatggcttcaggagtttggagtacctcagcaatacagcagtaggcaagtggcccacagt
ggagctaaaactgcagtgggggacgtagggcctctggtggcaccatcatctttaaatgca
gcaactgtggttaccacagtttaccaggaacccatcatgagtcaaggcgcagcactgagc
agcgagccaccagccttggtaaaggaggaagagaagaagcaatctgatgaggagccgatg
gacatggtggtagaaaaacaagacgatgctgacaagaatgctaatcagatactgacagat
attgctgaagcgaagatgacagaggagttgaagccaatggatactgataaggagagcata
gctgaatcaaagtccccggagatgtctatgcaggaggactctggtagtgatattgcccct
atgcagactgatgaacaaattaacaaagaacagtttgtgcctgggccaaatgaaaaacca
ctctacgcagtagaaccagtgactttagaggacttgcagcttcttgctgacttgttttat
ctcccgtatgaacacgggcccaaaggtgcacagatgctgagagaattccagtggcttaga
gcaaatagcagtgttgtcagtgttaactgcaaaggaaaggatgctgaaaaaatagaagaa
tggcgtaaccgagcagctaagtttgaagagatgtgcagcttggtgatgggaatgttcact
cgcctctccaattgtgccaacagaacaatcctttatgatatgtactcctacgtctgggat
atcaagagtattatgtcaatggtgaaatcttttgtgcaatggttagggtgtcgtagtcaa
tcttcagcacagttcttaagtggagaccaagaaccctgggcctttagaggtggtctagca
ggagagttccagcgtttgctgccaattgatggggcaaatgacctcttttttcaaccgcct
ccattaacgcccacttccaaggtgtacaccataagaccctacttccccaaagatgaggcg
tctgtatataagatctgcagagaaatgtacgctgatggagctgatcaacctttccacagc
ttaccagacttaattggagacaagttagtaggaggtctgctcaccctcagcctggattac
tgctttgtcttggaagatgaggatggcatatgtggctatgctttgggaacagttgatgtg
actcctttcattaagaagtgcaaaatgtcttggatccctttcatgcaagagaaatatact
aaaccaaatagtgacaaggagctgtctgaggcagagaaaataatgctaagcttccatgaa
gaacaagaagtgttgccagaatcattccttgccaacttcccatcattgataaagatcgat
atccacaaaaaagtgacagatccaagtgtggccaaaagcatgatggcctgcctgctctct
tctctaaaggctaatggctcccgtggggctttttgtgaagtgaggccagatgataaaaga
attctggaattctacagcaagctgggctgtttcgaaattgctaaaatggaaggatttcca
aaggatgttgttatccttggaagaagcctttga

DBGET integrated database retrieval system