KEGG   Meleagris gallopavo (turkey): 100550251Help
Entry
100550251         CDS       T01523                                 

Definition
ubiquitin carboxyl-terminal hydrolase BAP1-like
Orthology
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
mgp  Meleagris gallopavo (turkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
14
AA seq 317 aa AA seqDB search
LFTLLVEDFGVKGVQVEEIYDLQSKCQGPVYGFIFLFKWIEERRSRRKVSTLVDETSVID
DDIVNNMFFAHQLIPNSCATHALLSVLLNCNNVDLGPTLSRMKDFTKGFSPESKGYAIGN
APELAKAHNSHARPEPRHLPEKQNGISAVRTMEAFHFVSYVPIKGRLFELDGLKVYPIDH
GPWADDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRMKYESKLHILKMNRQ
TVLEALQQLIRVTQPELIQSQKSQESQSPEEAKPANSKTVAPESTHPDSTDEPASQGHTT
ATQSPPTKSKPMAKASA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtctcttcacactcctggtcgaagattttggggtcaaaggggtgcaggttgaagagattt
atgatctgcagagcaaatgccaaggccctgtgtatgggttcatcttcctgttcaagtgga
ttgaggagcgcagatcccgccggaaggtctctaccctggtggacgagacgtcagtgatcg
acgatgacatcgttaataacatgttctttgctcaccagctgatccccaattcctgtgcca
cccacgccctgctgagcgtcctcctgaactgcaacaatgttgacctgggccccacattga
gtcgcatgaaggatttcaccaaaggattcagccctgagagtaaaggctatgccatcggca
atgcccccgagctggccaaggcgcacaacagccatgccagaccagagccacggcacttgc
cagagaaacagaatgggatcagtgctgtgcgaaccatggaggctttccattttgtcagct
atgtccctatcaagggacggctgtttgagctggatgggctgaaggtctatcccattgacc
atgggccctgggctgacgatgaggaatggacagacaaagccaggagagtgatcatggagc
gcatcggcctggccactgcaggggagccataccacgacatccgtttcaacctgatggcag
tggttcctgatcggaggatgaaatatgagtctaagctccatatcctgaagatgaatcgcc
agactgtgctggaggccctgcagcagcttatccgagtcactcagcctgagctgatccagt
cccagaagtctcaggaatctcagtctcctgaagaggcaaagccagccaacagcaagactg
tggccccagagagtacccatccagacagcactgatgagcctgccagccagggccacacca
cggccacacagagcccacccaccaaatcaaaaccaatggcaaaggcatcagcga

DBGET integrated database retrieval system