KEGG   Meleagris gallopavo (turkey): 100550285Help
Entry
100550285         CDS       T01523                                 

Definition
GTP cyclohydrolase 1-like
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100550285
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     100550285
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 225 aa AA seqDB search
MTYFHHGKALFDISQGPLKAAATSFSPFPPSFLLQLHAPHGRFAGGSARASNPDPGDWLS
GDVRAAPANGSGAGGIKRAAALSQAGVCSDVLNDAIFDEDHDEMVIVKDIDMFSLCEHHL
VPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAIAITEALQPAGVGVV
IEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgacgtatttccatcacggaaaagcgctgtttgacatatcccaaggacccctgaaggca
gcggccacgtcgttttcccctttccccccatccttcctgttgcagctccatgctccccac
gggcggtttgcgggtggttcggcccgcgcctcgaacccggatcccggcgactggctgagc
ggtgacgtaagagcggcgccagccaacgggagcggcgcgggcggtataaagcgggccgct
gcgctcagtcaggcgggagtgtgttcagatgttctgaacgatgccatctttgacgaagac
cacgatgagatggtaattgtgaaggacatagacatgttctcattgtgtgagcatcacctc
gttccatttgttggaaaggtacatattggctatcttcctaacaaacaagtacttggcctc
agcaagctcgctaggattgtggagatatacagtagaagactacaagtccaggaacgcctt
accaaacaaattgcaatagccatcacagaagccttacagcctgctggagttggagtggtg
atcgaagctacgcatatgtgtatggtaatgcgtggggtacagaaaatgaacagtaaaact
gtaaccagcacaatgttgggggtattccgggaagacccaaagacccgtgaagagttcttg
acactcatcaggagctga

  All links  
No link information was found.   
DBGET integrated database retrieval system