KEGG   Meleagris gallopavo (turkey): 100550349Help
Entry
100550349         CDS       T01523                                 

Definition
ubiquitin carboxyl-terminal hydrolase 1-like
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.4.19.12]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    100550349
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100550349
Peptidases [BR:mgp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100550349
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
10
AA seq 819 aa AA seqDB search
MIVSVGKKHMEPLNVCKTALQAFRQAHFAYTTGILADAASRKSRRVLPLQEAGSLETGRS
GSSAPPPENEQKCAELRGAEIDQVVPAAQPPSLVSCEKKDNMLPFVGLNNLGNTCYLNSV
LQVLYFCPGFKTGIKHLYNIISKKKESLKDEGELKAEKGNCKEDPLASYELICSLHSLIL
SVEQLQASFLLNPEKYTDELATQPRRLLNTLRELNPMYEGYLQHDAQEVLQCILGNIQET
CQLLKKEELNKLPLEEPKAKVEEKINQSSESNGTGHSAEEEENTPSSHVGEIAEDKLPKG
NGKRKSDAEGGNAKKKSKVSKEQIAAEENQRQTRSKRKATGEKLENQTDAIAKCSAENES
AKPTQKKSRLKLNWLKSSCKQPSILSKFYSLGKLTTNLGSKDPVKEYDDCELEESTAKCE
NGNDIKEDGHEPTSPVESHNEKGTEKEPKKEGTELAVFELVEKLFQGQLVLRTRCLECEC
FTERREDFQDISVPVQEDELSKTEESSEISPEPKTEMKTLKWAISQFASVERIVGEDKYF
CENCHHYTEAERSLLFDKMPEVITIHLKCFAASGLEFDCYGGLSKINTPLLTPLKLSLEE
WSTKPTNDTYGLFAVVMHSGITISSGHYTASVKITDLNSLELDKGNFITAQMCETIKPEP
LNEEEARTVAEDYDNGEVSFRVNGNAQPGKVLNKKNMEAVGLLGGQKSKSDCDLYTNRPA
NSEKVLNVVTENRNPESGPANGSVECSTEHGDQNGVAFSGLENKALYVLQSLKEYEGKWL
LFDDSEVKVTEEKDFLNSLSPTSASTSTPYLLFYKKIVE
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atgattgtgtcagtcgggaagaaacacatggagccacttaatgtctgcaaaacagcgctg
caggcattccgtcaggctcattttgcttacacgactgggattttagcagatgcggcttca
agaaaaagcagaagggttttgcctctgcaggaagcaggcagcctggaaacgggcagaagc
ggaagcagcgctcctccgccggagaatgagcagaagtgcgcggagctccgcggcgcagag
attgaccaggttgttcctgcagcacagcctccctcgcttgtcagttgtgagaagaaggac
aacatgttgccttttgtgggcttgaataatcttggcaacacctgctaccttaacagcgtt
cttcaggtattatatttttgtcctggttttaaaacgggaatcaagcatttatataatatc
atttcaaagaagaaagaatcgttgaaggatgaaggagagctaaaagcagaaaagggaaat
tgtaaagaagatccactggcaagttatgaactgatctgcagtttgcactcgttgattctt
tctgttgaacagcttcaagccagctttcttttaaacccagagaaatacactgatgaactt
gctactcagccacgaaggctgctgaacacccttagagaactcaaccctatgtacgaaggc
tacttgcagcacgatgcccaggaagttctgcagtgcatccttggtaatattcaagaaaca
tgtcagctactgaagaaggaagaactgaataaactgcccttggaagagcccaaagctaaa
gtggaggaaaaaattaatcaaagttccgagagcaatggaactggccactctgccgaggag
gaggagaacacaccaagtagccatgtgggagagatagctgaagataagctgcccaaagga
aatgggaaaagaaaaagcgatgctgaaggtggcaacgcaaagaaaaagtccaaagtatcg
aaagaacaaattgcagcagaagaaaatcaaagacaaaccaggtcaaagaggaaggcaacg
ggagaaaagctagagaatcaaactgatgccattgccaagtgttccgccgagaacgagagc
gcaaagccaacacagaagaagtcacgacttaaattaaactggttaaaatcctcatgcaaa
cagccaagtattctgtccaaattttatagtctggggaagttaaccacaaatttgggatcc
aaagacccagtgaaagagtacgatgactgtgagcttgaagagtcaactgccaagtgtgaa
aatggtaacgatattaaagaagatggtcacgaaccaacatctcctgtggaaagccataat
gaaaaaggaactgaaaaagaaccaaaaaaggaaggtacagagttggctgtttttgaacta
gtggagaaattgttccagggccagttagtactgagaacacgatgcttggagtgcgagtgc
tttacagaaagaagagaggactttcaggacatcagtgttccagtgcaagaagatgaactt
tctaaaactgaagaaagttctgaaatttctccagagccaaaaacagagatgaagactctg
aagtgggcaatttcacagtttgcatccgtggaaaggattgtgggagaggataaatacttc
tgcgagaactgtcatcattacacagaagcagagcgcagccttttatttgataaaatgcct
gaagttataacaattcatttgaagtgctttgctgctagtggcttagagtttgattgctat
ggtggactatcgaagataaacactcccttactgacgccacttaaactgtcgctggaagaa
tggagcacgaagccaaccaatgacacctatgggttatttgcagtggtgatgcacagtggc
atcacaattagcagcggacactacacagcttctgtcaaaatcacagatctcaacagcctg
gagttagacaagggaaacttcatcactgcccaaatgtgcgaaacgattaaaccagaacca
ctgaatgaggaggaagcaagaactgttgctgaagactacgacaacggtgaagtctctttt
agagtcaatggcaatgcacagccaggtaaagttctgaacaaaaagaacatggaagctgtc
ggacttcttgggggacagaagagcaagtctgactgtgacctgtacaccaacagaccagca
aacagcgagaaggttctcaatgtagttactgagaacagaaatcccgagtctggccctgct
aatggaagtgtggagtgcagcactgaacacggcgatcagaacggggttgctttcagtgga
ctggaaaacaaagctttgtatgtcctgcagagcctgaaagagtacgaagggaaatggttg
cttttcgatgattctgaagtgaaagttacagaggaaaaggacttcctgaattctctttct
cccacgtcagcatctacatcaactccttacctactgttttataagaaaattgtagagtga

DBGET integrated database retrieval system