KEGG   Meleagris gallopavo (turkey): 100550349Help
Entry
100550349         CDS       T01523                                 

Gene name
USP1
Definition
(RefSeq) ubiquitin specific peptidase 1
  KO
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.4.19.12]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    100550349 (USP1)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100550349 (USP1)
Peptidases [BR:mgp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100550349 (USP1)
Ubiquitin system [BR:mgp04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100550349 (USP1)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     100550349 (USP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
10
AA seq 718 aa AA seqDB search
MLPFVGLNNLGNTCYLNSVLQVLYFCPGFKTGIKHLYNIISKKKESLKDEGELKAEKGNC
KEDPLASYELICSLHSLILSVEQLQASFLLNPEKYTDELATQPRRLLNTLRELNPMYEGY
LQHDAQEVLQCILGNIQETCQLLKKEELNKLPLEEPKAKVEEKINQSSESNGTGHSAEEE
ENTPSSHVGEIAEDKLPKGNGKRKSDAEGGNAKKKSKVSKEQIAAEENQRQTRSKRKATG
EKLENQTDAIAKCSAENESAKPTQKKSRLKLNWLKSSCKQPSILSKFYSLGKLTTNLGSK
DPVKEYDDCELEESTAKCENGNDIKEDGHEPTSPVESHNEKGTEKEPKKEGTELAVFELV
EKLFQGQLVLRTRCLECECFTERREDFQDISVPVQEDELSKTEESSEISPEPKTEMKTLK
WAISQFASVERIVGEDKYFCENCHHYTEAERSLLFDKMPEVITIHLKCFAASGLEFDCYG
GLSKINTPLLTPLKLSLEEWSTKPTNDTYGLFAVVMHSGITISSGHYTASVKITDLNSLE
LDKGNFITAQMCETIKPEPLNEEEARTVAEDYDNGEVSFRVNGNAQPGKVLNKKNMEAVG
LLGGQKSKSDCDLYTNRPANSEKVLNVVTENRNPESGPANGSVECSTEHGDQNGVAFSGL
ENKALYVLQSLKEYEGKWLLFDDSEVKVTEEKDFLNSLSPTSASTSTPYLLFYKKIVE
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgttgccttttgtgggcttgaataatcttggcaacacctgctaccttaacagcgttctt
caggtattatatttttgtcctggttttaaaacgggaatcaagcatttatataatatcatt
tcaaagaagaaagaatcgttgaaggatgaaggagagctaaaagcagaaaagggaaattgt
aaagaagatccactggcaagttatgaactgatctgcagtttgcactcgttgattctttct
gttgaacagcttcaagccagctttcttttaaacccagagaaatacactgatgaacttgct
actcagccacgaaggctgctgaacacccttagagaactcaaccctatgtacgaaggctac
ttgcagcacgatgcccaggaagttctgcagtgcatccttggtaatattcaagaaacatgt
cagctactgaagaaggaagaactgaataaactgcccttggaagagcccaaagctaaagtg
gaggaaaaaattaatcaaagttccgagagcaatggaactggccactctgccgaggaggag
gagaacacaccaagtagccatgtgggagagatagctgaagataagctgcccaaaggaaat
gggaaaagaaaaagcgatgctgaaggtggcaacgcaaagaaaaagtccaaagtatcgaaa
gaacaaattgcagcagaagaaaatcaaagacaaaccaggtcaaagaggaaggcaacggga
gaaaagctagagaatcaaactgatgccattgccaagtgttccgccgagaacgagagcgca
aagccaacacagaagaagtcacgacttaaattaaactggttaaaatcctcatgcaaacag
ccaagtattctgtccaaattttatagtctggggaagttaaccacaaatttgggatccaaa
gacccagtgaaagagtacgatgactgtgagcttgaagagtcaactgccaagtgtgaaaat
ggtaacgatattaaagaagatggtcacgaaccaacatctcctgtggaaagccataatgaa
aaaggaactgaaaaagaaccaaaaaaggaaggtacagagttggctgtttttgaactagtg
gagaaattgttccagggccagttagtactgagaacacgatgcttggagtgcgagtgcttt
acagaaagaagagaggactttcaggacatcagtgttccagtgcaagaagatgaactttct
aaaactgaagaaagttctgaaatttctccagagccaaaaacagagatgaagactctgaag
tgggcaatttcacagtttgcatccgtggaaaggattgtgggagaggataaatacttctgc
gagaactgtcatcattacacagaagcagagcgcagccttttatttgataaaatgcctgaa
gttataacaattcatttgaagtgctttgctgctagtggcttagagtttgattgctatggt
ggactatcgaagataaacactcccttactgacgccacttaaactgtcgctggaagaatgg
agcacgaagccaaccaatgacacctatgggttatttgcagtggtgatgcacagtggcatc
acaattagcagcggacactacacagcttctgtcaaaatcacagatctcaacagcctggag
ttagacaagggaaacttcatcactgcccaaatgtgcgaaacgattaaaccagaaccactg
aatgaggaggaagcaagaactgttgctgaagactacgacaacggtgaagtctcttttaga
gtcaatggcaatgcacagccaggtaaagttctgaacaaaaagaacatggaagctgtcgga
cttcttgggggacagaagagcaagtctgactgtgacctgtacaccaacagaccagcaaac
agcgagaaggttctcaatgtagttactgagaacagaaatcccgagtctggccctgctaat
ggaagtgtggagtgcagcactgaacacggcgatcagaacggggttgctttcagtggactg
gaaaacaaagctttgtatgtcctgcagagcctgaaagagtacgaagggaaatggttgctt
ttcgatgattctgaagtgaaagttacagaggaaaaggacttcctgaattctctttctccc
acgtcagcatctacatcaactccttacctactgttttataagaaaattgtagagtga

DBGET integrated database retrieval system