KEGG   Meleagris gallopavo (turkey): 100550438Help
Entry
100550438         CDS       T01523                                 

Gene name
PTPN5
Definition
protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched)
Orthology
K18018  
tyrosine-protein phosphatase non-receptor type 5 [EC:3.1.3.48]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:mgp04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 468 aa AA seqDB search
MMLWYSTYGTISAAQNAFDMLFYLLTPFEQSLSDQGGNLTRIGNVVISYILLSLVSLGLL
LVGSLFWHLLRARPDPPFPLQEDRRQSVSRQPSFTYSEWTEDKNEDDFLDLDPVPETPVF
DCVMDIKVETDPATLTVKSVGLQERRGSNVSLTLDMCTPGCSEQGFGYIMSPREQSAQEY
LQTASNILTEEELHKKALDSFILQAEFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHS
RVCLTSADQDDPLSSYINANYIRGYGGEEKVYIATQGPIVNTVSDFWRMVWQERSPIIVM
ITNIEEMNEKCTEYWPEEQITYEGIEIIVNQVIQADDYRLRLITLKKGEEVRNLKHYWYT
SWPDQKTPDQAPPLLQLVLEVEEAMQSAEEKNAPVIVHCSAGIGRTGCFIATSVCCKQLK
SEGIVDILRTTCQLRLDRGGMIQTCEQYQFVHHVMSLYGKQLSRAAEE
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgatgctgtggtacagcacttatgggaccatctcagcagctcagaatgcctttgacatg
ctgttttacttgcttaccccatttgaacagtctttgtcagatcaaggagggaatctaacc
agaattgggaatgttgtgatatcgtatatcctgctgtccttagtttctctaggactgcta
cttgttggatctctgttttggcatctgctcagagctcgtccagaccccccctttccgcta
caggaggacagacgccaatctgtgagccggcagccttcattcacatactcagagtggaca
gaagataaaaatgaggatgacttcctagacttggatcctgtaccagagaccccagtcttt
gactgtgtaatggacattaaagtggagacagacccagctactctaacagttaaatccgtg
ggcttgcaagaaaggaggggttccaatgtttcactcacactagatatgtgtaccccaggc
tgttctgagcaaggttttggctatatcatgtcaccacgggaacagtcagcacaagaatat
ctccagacagcatcaaacattcttactgaagaagaacttcacaagaaagctctggattca
ttcatacttcaggcagaattctttgaaattccaatgaactttgttgatccaaaggaatat
gatattccaggcctggtgcggaagaatcgctacaaaacaattcttccaaatcctcacagc
agagtgtgccttacctcagctgatcaggacgacccccttagctcttacatcaatgctaac
tacatcaggggctacggaggagaggaaaaagtgtatattgctactcagggaccaatagtt
aacactgtcagtgatttctggagaatggtgtggcaggagcgttctcccatcattgtcatg
attaccaatatagaggaaatgaacgagaaatgcacagaatattggccagaggaacagatc
acctatgaaggaatagaaatcatagttaaccaagtcatacaagcagatgactaccgttta
aggctcatcaccctaaagaaaggagaagaagtcagaaacctgaaacattactggtacacg
tcttggccagaccagaagacaccagatcaagctcctcctctgttacaactagtactggaa
gtggaagaggcaatgcagagtgcagaagagaagaatgctccagtgattgttcactgcagt
gcaggcatcgggaggacgggctgctttattgcaactagtgtctgttgtaaacagctgaag
agtgagggaatagttgacatattgcgaacaacttgccagttacggttagacaggggagga
atgatccagacttgtgaacagtatcaatttgtccatcatgtcatgagcttgtacggaaaa
cagctttctagagcagcagaagaataa

DBGET integrated database retrieval system