KEGG   Meleagris gallopavo (turkey): 100550438Help
Entry
100550438         CDS       T01523                                 

Gene name
PTPN5
Definition
(RefSeq) protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched)
  KO
K18018  
tyrosine-protein phosphatase non-receptor type 5 [EC:3.1.3.48]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100550438 (PTPN5)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100550438 (PTPN5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 525 aa AA seqDB search
MESMGEAQGQQEQLNRKEQSLKTTQKTALLAWAAWWNGLMTGDSMYLFVLSQILLLCMML
WYSTYGTISAAQNAFDMLFYLLTPFEQSLSDQGGNLTRIGNVVISYILLSLVSLGLLLVG
SLFWHLLRARPDPPFPLQEDRRQSVSRQPSFTYSEWTEDKNEDDFLDLDPVPETPVFDCV
MDIKVETDPATLTVKSVGLQERRGSNVSLTLDMCTPGCSEQGFGYIMSPREQSAQEYLQT
ASNILTEEELHKKALDSFILQAEFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSRVC
LTSADQDDPLSSYINANYIRGYGGEEKVYIATQGPIVNTVSDFWRMVWQERSPIIVMITN
IEEMNEKCTEYWPEEQITYEGIEIIVNQVIQADDYRLRLITLKKGEEVRNLKHYWYTSWP
DQKTPDQAPPLLQLVLEVEEAMQSAEEKNAPVIVHCSAGIGRTGCFIATSVCCKQLKSEG
IVDILRTTCQLRLDRGGMIQTCEQYQFVHHVMSLYGKQLSRAAEE
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggagtcaatgggtgaagctcaagggcaacaagaacagctgaacaggaaggagcagtcc
ctgaaaaccacccagaaaactgcgctgcttgcttgggctgcctggtggaatggattaatg
actggagacagcatgtatctgtttgtcctctctcagatactgcttctctgcatgatgctg
tggtacagcacttatgggaccatctcagcagctcagaatgcctttgacatgctgttttac
ttgcttaccccatttgaacagtctttgtcagatcaaggagggaatctaaccagaattggg
aatgttgtgatatcgtatatcctgctgtccttagtttctctaggactgctacttgttgga
tctctgttttggcatctgctcagagctcgtccagaccccccctttccgctacaggaggac
agacgccaatctgtgagccggcagccttcattcacatactcagagtggacagaagataaa
aatgaggatgacttcctagacttggatcctgtaccagagaccccagtctttgactgtgta
atggacattaaagtggagacagacccagctactctaacagttaaatccgtgggcttgcaa
gaaaggaggggttccaatgtttcactcacactagatatgtgtaccccaggctgttctgag
caaggttttggctatatcatgtcaccacgggaacagtcagcacaagaatatctccagaca
gcatcaaacattcttactgaagaagaacttcacaagaaagctctggattcattcatactt
caggcagaattctttgaaattccaatgaactttgttgatccaaaggaatatgatattcca
ggcctggtgcggaagaatcgctacaaaacaattcttccaaatcctcacagcagagtgtgc
cttacctcagctgatcaggacgacccccttagctcttacatcaatgctaactacatcagg
ggctacggaggagaggaaaaagtgtatattgctactcagggaccaatagttaacactgtc
agtgatttctggagaatggtgtggcaggagcgttctcccatcattgtcatgattaccaat
atagaggaaatgaacgagaaatgcacagaatattggccagaggaacagatcacctatgaa
ggaatagaaatcatagttaaccaagtcatacaagcagatgactaccgtttaaggctcatc
accctaaagaaaggagaagaagtcagaaacctgaaacattactggtacacgtcttggcca
gaccagaagacaccagatcaagctcctcctctgttacaactagtactggaagtggaagag
gcaatgcagagtgcagaagagaagaatgctccagtgattgttcactgcagtgcaggcatc
gggaggacgggctgctttattgcaactagtgtctgttgtaaacagctgaagagtgaggga
atagttgacatattgcgaacaacttgccagttacggttagacaggggaggaatgatccag
acttgtgaacagtatcaatttgtccatcatgtcatgagcttgtacggaaaacagctttct
agagcagcagaagaataa

DBGET integrated database retrieval system