KEGG   Meleagris gallopavo (turkey): 100550535Help
Entry
100550535         CDS       T01523                                 

Definition
lymphokine-activated killer T-cell-originated protein kinase-like
Orthology
K08865  
PDZ-binding kinase [EC:2.7.12.2]
Organism
mgp  Meleagris gallopavo (turkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 322 aa AA seqDB search
MEAKKCQSSLEQKEKAGPASITIPASPSMQKLGYGTGVNVYLMKRSPRGLSRSPWAVKKI
NSKCNKNQQNIYQSRLNEEAKILKSLKHPNIVGYRAFTEANDGSMCLVMEFGGEKSLNDL
IEERNAARLGPFPAATISKVALSMARGLKYLHNDKKLLHGDIKSPNVVVKGDFEAIKICD
VGVSLPLDENLTVSDPTVHYIGTEPWKPKEALSDDGVITDKADIFSFGLTLWEMMTLSVP
HLNLGSSTDDEDESFDEDDFDEEAYYAALGTRPALNMDELDSSYQQVIELFSICTSEDPK
KRPSAAHVVAVLEASLPPELRA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggaagccaagaaatgtcagagcagcctggagcagaaggagaaagccgggccagcttct
atcactattcctgcctccccctccatgcagaagcttggatacggtactggggtgaacgtc
tacttgatgaaaagatctcccagaggtttatctcgatccccttgggctgtgaagaaaatt
aattccaaatgcaataaaaatcagcaaaacatctatcagtccagactgaacgaagaggcc
aagatcttgaaaagcctcaagcaccccaacattgtgggttaccgtgcattcactgaagcc
aacgatggaagcatgtgtcttgtcatggagtttggaggagaaaaatctctcaatgactta
attgaagaaagaaatgcagctcgtttgggccctttccctgctgcaacaatttccaaagtt
gccttgagcatggcaagggggctgaagtaccttcacaatgacaagaagctgctccatgga
gatatcaagtctcccaatgttgttgttaagggtgactttgaagccatcaagatctgtgac
gtgggagtatctctgcctctggatgagaacctgaccgtgagtgaccctacagtgcactac
attggcaccgagccctggaagcccaaggaagctctgagtgatgatggtgtgatcactgac
aaggctgacatcttctcctttgggctgaccctctgggaaatgatgaccctctctgtgccc
cacctcaacctgggcagcagcaccgatgatgaagatgagtcttttgatgaggatgacttt
gatgaagaagcatattatgcagctttgggaacccgtccagccctgaacatggatgagctg
gactcatcctaccagcaggtgattgagctcttctctatctgcaccagtgaggacccaaag
aaacgtccctcagctgctcatgttgtggcagtcctggaggcaagcctgcccccagagctc
agggcctga

DBGET integrated database retrieval system