KEGG   Meleagris gallopavo (turkey): 100550588Help
Entry
100550588         CDS       T01523                                 

Definition
(RefSeq) 7-dehydrocholesterol reductase-like
  KO
K00213  7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00100  Steroid biosynthesis
mgp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    100550588
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     100550588
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT Orf78
Motif
Other DBs
NCBI-GeneID: 100550588
NCBI-ProteinID: XP_003206156
Ensembl: ENSMGAG00000002390
Position
5
AA seq 474 aa AA seqDB search
MAAHREKKSEERNNKSARNGAQAPQAQWGRAWEVDWFSLASILFLLAFAPLIVYYFIMSC
DQYQCSLTDPLINLLMGNKHLSDIWNKTPSLTYTAAGIYAAWVAFQVILYAFVPDFCHKF
IPGYVGGVQEGAVTPAGVVNKYEINGLQAWIITHILWFANAYYFHYFSPTIIFDNWIPLL
WCANILGYVVSTFAMIKGYFFPTNAKDCKFTGNFFYDYMMGIEFNPRIGKWFDFKLFFNG
RPGIVAWTLINLSYAAKQQELYGHVTNSMILVNVLQGIYVLDYFWNEAWYLKTIDICHDH
FGWYLGWGDCVWLPNLYTLQGLYLVYHPVQLCTANAIGILALGLAGYYIFRMTNHQKDLF
RRTNGNCKIWGKKPDYIECSYMSVDGTKYYSKLLTSGFWGWARHFNYTGDLMGSLAYCLT
CGFEHILPYFYIVYMTILLTHRCIRDEHRCYSKYGKDWKRYTAAVPYRLIPGLF
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggcagcccatcgggagaaaaaatctgaagaaaggaataacaaaagtgcccgaaatggt
gctcaggctcctcaggcacagtggggaagagcatgggaggtagactggttttcgttggca
agcattcttttcctactcgcatttgcaccccttattgtgtattacttcatcatgtcctgc
gaccaataccagtgctctctgactgatccactcatcaacttgctcatggggaataaacat
ctgtctgacatctggaacaagactccttcactgacttacacggctgctggcatctatgct
gcttgggttgctttccaggtgattttgtatgcgtttgttcctgacttctgccacaagttt
attcccggatatgtaggaggtgtacaagaaggtgctgtcactcctgctggtgtagtaaat
aagtatgaaatcaatggactccaagcttggatcattacccacatactttggtttgcaaac
gcctattatttccactacttctcacctaccatcatctttgacaattggattcctctcctg
tggtgtgccaatatcctgggatatgtagtttccacatttgcgatgattaaaggctacttc
ttccctactaatgccaaggattgcaaattcactggcaacttcttttacgactacatgatg
gggattgaatttaaccctcgaatagggaagtggtttgatttcaagctgttcttcaatgga
cgccctggtattgtagcctggactctgattaacctttcatatgctgctaaacagcaggag
ctgtatggtcacgtaaccaactcaatgatccttgtcaatgtccttcagggtatttatgtt
ttggactatttctggaatgaagcctggtatttgaaaaccattgatatctgccacgatcac
tttggatggtacttgggctggggagactgcgtttggttgcctaacctctacactctgcag
ggcttatatttggtttaccaccctgtgcagctctgcacagctaatgccatcgggatcttg
gcgttgggcttggctggctattacatcttcagaatgacaaaccaccagaaagatctcttc
cgccgtaccaatggcaactgcaagatatggggcaagaagcccgactacattgagtgctcc
tacatgtctgtggatgggaccaagtactacagcaagctgctgacctcggggttctggggg
tgggcacgccattttaactacactggagatctgatgggctccctggcctactgtctgacc
tgtgggtttgaacacatcttgccttacttctacattgtttatatgactattctgctaact
caccgttgcattagggacgaacaccgttgttacagcaaatacgggaaagactggaaacgc
tacactgctgcagtgccctaccggctcataccagggctgttttaa

DBGET integrated database retrieval system