KEGG   Meleagris gallopavo (turkey): 100550679Help
Entry
100550679         CDS       T01523                                 

Definition
(RefSeq) NADH-cytochrome b5 reductase 3
  KO
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100550679
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     100550679
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 300 aa AA seqDB search
SLFVPQLSWVVTYPLWLIYSTVRRLFGTPRPAITLKDPEVKYALRLIDKEEVSHDTRRFR
FALPSMDHVLGLPIGQHIYLSARINGALVIRPYTPISSDDDKGFVDLVIKVYMKGVHPKF
PDGGKMSQYLDSLKIGDTIDFRGPSGLLVYKGKGEFAIRPEKKAQPVTKKVKYVGMIAGG
TGITPMLQIIRAIMKDKDDCTVCQLLFANQTEKDILQRSELEEIQVQHPNRFKYWYTLDK
APENWEYSQGFVNQDMIRDHLPPPQSDVLILMCGPPPMIQYACIPNLDKLGYAKDMRFSF
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
tctctgtttgtgccacagctgagttgggttgtgacatacccattatggctcatctacagc
actgtccggaggctttttgggactcctcgtcctgcaatcactctgaaggatcctgaagtg
aagtatgcattgaggctgattgataaagaggaagtaagccatgacacaaggagatttcgg
tttgctctcccttccatggatcacgttctgggactaccaattggacagcatatctacctg
tctgcgcggatcaatggagcgctggtcattagaccttacactccgatttccagtgacgat
gacaagggcttcgtggatcttgttatcaaggtttacatgaaaggtgtccatccgaaattt
cctgacggagggaagatgtctcagtacttagacagcctgaaaataggggataccattgac
ttcagaggaccaagtggcctgcttgtctacaaaggaaaaggtgagtttgctattcgacct
gagaagaaagcccaaccggttactaagaaagtgaagtatgtggggatgatcgcaggtggg
actgggataacacctatgctgcagatcattcgagcaatcatgaaagacaaggatgactgc
acggtttgccagctgctgtttgctaatcagactgagaaggatatcctgcaacgctcagag
ctggaagagattcaggttcagcaccccaaccgttttaagtattggtacacactggataaa
gcacctgaaaattgggagtacagccaaggatttgtgaaccaagatatgatcagagaccac
ctgcccccacctcagagtgatgttctgatcctcatgtgtggacctcctcccatgatccag
tatgcgtgcattcccaacctggacaaactgggctatgccaaggacatgaggttctccttc
taa

DBGET integrated database retrieval system