KEGG   Meleagris gallopavo (turkey): 100550679Help
Entry
100550679         CDS       T01523                                 

Definition
NADH-cytochrome b5 reductase 3-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Amino sugar and nucleotide sugar metabolism
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mgp00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 358 aa AA seqDB search
METHAASFDQWQIPCSLAERTSRCSVGKANSLSRVWLRAVIYHDQTQVCLQWDFGANVYL
NCVGLSWVVTYPLWLIYSTVRRLFGTPRPAITLKDPEVKYALRLIDKEEVSHDTRRFRFA
LPSMDHVLGLPIGQHIYLSARINGALVIRPYTPISSDDDKGFVDLVIKVYMKGVHPKFPD
GGKMSQYLDSLKIGDTIDFRGPSGLLVYKGKGEFAIRPEKKAQPVTKKVKYVGMIAGGTG
ITPMLQIIRAIMKDKDDCTVCQLLFANQTEKDILQRSELEEIQVQHPNRFKYWYTLDKAP
ENWEYSQGFVNQDMIRDHLPPPQSDVLILMCGPPPMIQYACIPNLDKLGYAKDMRFSF
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggagacacatgctgcatcctttgaccagtggcagattccatgctctctagcagaaaga
acaagcaggtgtagtgtggggaaagcaaattctctcagcagggtatggctgagagctgta
atatatcatgaccagacccaggtctgcctgcaatgggacttcggagccaatgtgtacctc
aactgtgttgggctgagttgggttgtgacatacccattatggctcatctacagcactgtc
cggaggctttttgggactcctcgtcctgcaatcactctgaaggatcctgaagtgaagtat
gcattgaggctgattgataaagaggaagtaagccatgacacaaggagatttcggtttgct
ctcccttccatggatcacgttctgggactaccaattggacagcatatctacctgtctgcg
cggatcaatggagcgctggtcattagaccttacactccgatttccagtgacgatgacaag
ggcttcgtggatcttgttatcaaggtttacatgaaaggtgtccatccgaaatttcctgac
ggagggaagatgtctcagtacttagacagcctgaaaataggggataccattgacttcaga
ggaccaagtggcctgcttgtctacaaaggaaaaggtgagtttgctattcgacctgagaag
aaagcccaaccggttactaagaaagtgaagtatgtggggatgatcgcaggtgggactggg
ataacacctatgctgcagatcattcgagcaatcatgaaagacaaggatgactgcacggtt
tgccagctgctgtttgctaatcagactgagaaggatatcctgcaacgctcagagctggaa
gagattcaggttcagcaccccaaccgttttaagtattggtacacactggataaagcacct
gaaaattgggagtacagccaaggatttgtgaaccaagatatgatcagagaccacctgccc
ccacctcagagtgatgttctgatcctcatgtgtggacctcctcccatgatccagtatgcg
tgcattcccaacctggacaaactgggctatgccaaggacatgaggttctccttctaa

DBGET integrated database retrieval system