KEGG   Meleagris gallopavo (turkey): 100550682Help
Entry
100550682         CDS       T01523                                 

Gene name
SETDB2
Definition
(RefSeq) SET domain, bifurcated 2
  KO
K18494  
histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100550682 (SETDB2)
Enzymes [BR:mgp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100550682 (SETDB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 728 aa AA seqDB search
MEGNRMLHGCSEEKNRPTSRKETAEGDLKAFWTQLESRKVDLIFEQVQEVLLLLKEKIKN
GTATNQECWQAWTLVNEADLGDLLTLTSVNDVLDEEDTQEPNPKSPKSQHPVTDDNSGNT
VEGSHSKKETVEKSDSGSEEASSEIQRVPLNRQYRIHKCSSACLSNRAVSSYKGENPLKI
PVLFHFQRRHAKADCLSKSLDVHYKAPCGRSLRSFQDVQNYLFETKCDFLFIDHFSFNTY
VLLGRNTVNPEPLVFDLDISNGAESVPISFCNDIDRARLPYFKYRRASWPRGYYLNNLSS
MFLDSCDCTDGCIDRSKCACLQLTARGCRKVSLSLSTKTSRGYSYKRLEGPVPSGIYECS
VSCRCDKMMCQNRVVQHGIQVRLQVFNTEKKGWGVRCLDDIDKGTFVCTYSGRLMSRAEV
QELGGADQDLKEESAVNDRGQSFFSXKRKLDSSCSDSEIELVQTGKDDILEQQEPSSDNE
NESALIHPRNVKTAAVRRLGTRIAVVDNHQLKMEVDTLVHSASSDEDNISQPQHSSKTEL
TSGTNKEKERSIQKQKEEDLVEVGQTEPAEMGSAECRRKSLSLKGVACGRSDVLNDKYVV
KPSTKVPKKANCKEEAHRQSKQGIICMDADGDRTLLKNANDENIYILDATKEGNVGRFLN
HSCCPNLFAQSVFVETHNRSFPWVAFFTNRHVKAGTELTWDYGYEAGSMPETEISCWCGV
QKCRKKTL
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atggaggggaaccgaatgctgcatggctgttctgaagagaagaaccgtcccacttccagg
aaagagacagctgaaggtgatttgaaggcattttggacacaactggaaagtagaaaagtg
gatctcatatttgagcaggtgcaagaagtactgctgctgctaaaggaaaagatcaagaat
ggaactgccacaaatcaagaatgctggcaggcttggacactggtaaacgaagctgatctg
ggtgatcttttaacgttgacaagtgtaaatgatgttcttgatgaagaagatacacaggaa
ccaaatcctaaatcacctaaatcacagcatcctgttacagatgacaacagtggaaacact
gtagagggttcacacagcaaaaaggagacggttgaaaaatcagattcagggagtgaggaa
gcatcaagtgaaattcaacgtgtacctttaaatcgccagtatcggatccacaagtgctcc
agtgcatgtctctccaacagagcagtaagctcctacaagggtgaaaatcctcttaagata
ccagtactgtttcactttcaaagacgccatgcgaaagcagactgcctttcaaaatcactg
gatgtgcattacaaagctccctgtggcaggagtctgagaagttttcaagatgttcaaaat
tatttgtttgagacaaaatgtgatttcttatttattgatcacttctctttcaacacatac
gtcctgttgggcaggaacactgtaaatccagaaccccttgtgtttgatcttgatattagc
aatggagctgaatctgtgcctatttccttctgtaatgacattgaccgtgccagattacct
tattttaaataccggagggcatcgtggcctcgtggatattatctcaacaatttatccagc
atgtttcttgattcatgtgactgcacggatggctgcattgataggtccaagtgtgcatgt
ctgcagctaactgcaagaggctgccgtaaagtttctctgtctcttagtactaaaacgtct
cgtggatacagttacaaaagactggaagggcctgttcctagtggaatttatgagtgtagc
gtgtcgtgcagatgtgacaagatgatgtgtcaaaacagagttgtacagcatggcattcaa
gttcggttgcaagtgttcaacacagagaagaagggttggggcgtccgctgcctggatgat
atcgacaaggggacgtttgtttgtacttactcaggcaggttaatgagcagagctgaagtt
caagagttgggaggtgctgatcaagacttgaaagaggagagcgctgtgaatgacagaggg
caaagctttttttccnaaaaaagaaaacttgactctagctgttcagactctgagattgaa
ctcgtgcagactggcaaagatgatattcttgagcagcaggaaccttcttctgataatgaa
aatgaatcagctctaattcatccaaggaatgtgaaaactgcagctgtgagaaggcttgga
actagaatagctgttgtggataatcaccagctgaaaatggaggttgatactctggtgcac
agtgccagctcagatgaagataatatttctcagcctcagcattcaagcaaaacagaactg
accagtggaacaaacaaagaaaaagaaagatccatccagaagcagaaggaagaagatctg
gtggaagttggacagacggagcctgctgagatgggcagtgcagaatgcagaaggaagagt
ctgtctctgaagggtgttgcttgtggcagatcagatgtgctgaatgataaatacgttgtg
aagccgtccacaaaggttccaaaaaaagctaactgcaaagaggaagctcacagacagtca
aaacaaggcataatttgtatggatgcagatggtgacaggacgcttctgaagaatgctaat
gatgaaaatatctatatactagatgccacgaaagaaggaaatgtgggtcgttttcttaat
cacagctgctgccccaatctctttgcacagagtgtgtttgtagagactcacaacagaagt
ttcccatgggttgctttcttcacaaacaggcatgtgaaagctggaactgaactcacgtgg
gattatggatatgaagctggaagtatgccagagacagagatttcctgttggtgtggagtt
cagaaatgcaggaagaaaaccttatag

DBGET integrated database retrieval system