KEGG   Meleagris gallopavo (turkey): 100550682Help
Entry
100550682         CDS       T01523                                 

Gene name
SETDB2
Definition
(RefSeq) histone-lysine N-methyltransferase SETDB2
  KO
K18494  
histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100550682 (SETDB2)
Enzymes [BR:mgp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100550682 (SETDB2)
Chromosome [BR:mgp03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100550682 (SETDB2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100550682 (SETDB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 1174 aa AA seqDB search
MEGNRMLHGCSEEKNRPTSRKETAEGDLKAFWTQLESRKVDLIFEQVQEVLLLLKEKIKN
GTATNQECWQAWTLVNEADLGDLLTLTSVNDVLDEEDTQEPNPKSPKSQHPVTDDNSGNT
VEGSHSKKETVEKSDSGSEEASSEIQRVPLNRQYRIHKCSSACLSNRAVSSYKGENPLKI
PVLFHFQRRHAKADCLSKSLDVHYKAPCGRSLRSFQDVQNYLFETKCDFLFIDHFSFNTY
VLLGRNTVNPEPLVFDLDISNGAESVPISFCNDIDRARLPYFKYRRASWPRGYYLNNLSS
MFLDSCDCTDGCIDRSKCACLQLTARGCRKVSLSLSTKTSRGYSYKRLEGPVPSGIYECS
VSCRCDKMMCQNRVVQHGIQVRLQVFNTEKKGWGVRCLDDIDKGTFVCTYSGRLMSRAEV
QELGGADQDLKEESAVNDRAKLFFQKRKLDSSCSDSEIELVQTGKDDILEQQEPSSDNEN
ESALIHPRNVKTAAVRRLGTRIAVVDNHQLKMEVDTLVHSASSDEDNISQPQHSSKTELT
SGTNKEKERSIQKQKEEDLVEVGQTEPAEMGSAECRRKSLSLKGVACGRSDVLNDKYVVK
PSTKVPKKANCKEEAHRQSKQGIICMDADGDRTLLKNANDENIYILDATKEGNVGRFLNH
SCCPNLFAQSVFVETHNRSFPWVAFFTNRHVKAGTELTWDYGYEAGSMPETEISCWCGVQ
KCRKKTLAGGGSGIRTGDPSSTTPKGAGMSREPLPHHTTLTPPIPARIPYTSQSAARSTT
PSPRAAGRPVPFCRSRRAGKHCGAWNESVREWLRASGAARPSASGAGESREPMRSPAIIS
VTLNGCEKGRTSRSVHLLKKIVETFPVWQADGGFVVEALRLPVPGALQAMAKMVRRTCAF
CSEGEAASIMYVAKEQNIAAHQSCLLFSSGFVESEEYNPENLDLRFDVESVLNELKRGKR
LVCNFCRKKGATVGCEERACRRSYHYFCALCDDAAIETDEVNGVYRVFCSKHDPGNRTNH
YDAANKRKRHASKSSTTMEQMRAEETAEDNRLRILRRKSSRHKVRIDFLRKCKQAGLLDD
IFEEMLDTLHLAQEKLMDDNTSETEYEETVISLFDCGLFENILTNIHSGTEEKIQELLKS
RKRLDNQIELLQELKEVSLPSQESTASTSSTVSE
NT seq 3525 nt NT seq  +upstreamnt  +downstreamnt
atggaggggaaccgaatgctgcatggctgttctgaagagaagaaccgtcccacttccagg
aaagagacagctgaaggtgatttgaaggcattttggacacaactggaaagtagaaaagtg
gatctcatatttgagcaggtgcaagaagtactgctgctgctaaaggaaaagatcaagaat
ggaactgccacaaatcaagaatgctggcaggcttggacactggtaaacgaagctgatctg
ggtgatcttttaacgttgacaagtgtaaatgatgttcttgatgaagaagatacacaggaa
ccaaatcctaaatcacctaaatcacagcatcctgttacagatgacaacagtggaaacact
gtagagggttcacacagcaaaaaggagacggttgaaaaatcagattcagggagtgaggaa
gcatcaagtgaaattcaacgtgtacctttaaatcgccagtatcggatccacaagtgctcc
agtgcatgtctctccaacagagcagtaagctcctacaagggtgaaaatcctcttaagata
ccagtactgtttcactttcaaagacgccatgcgaaagcagactgcctttcaaaatcactg
gatgtgcattacaaagctccctgtggcaggagtctgagaagttttcaagatgttcaaaat
tatttgtttgagacaaaatgtgatttcttatttattgatcacttctctttcaacacatac
gtcctgttgggcaggaacactgtaaatccagaaccccttgtgtttgatcttgatattagc
aatggagctgaatctgtgcctatttccttctgtaatgacattgaccgtgccagattacct
tattttaaataccggagggcatcgtggcctcgtggatattatctcaacaatttatccagc
atgtttcttgattcatgtgactgcacggatggctgcattgataggtccaagtgtgcatgt
ctgcagctaactgcaagaggctgccgtaaagtttctctgtctcttagtactaaaacgtct
cgtggatacagttacaaaagactggaagggcctgttcctagtggaatttatgagtgtagc
gtgtcgtgcagatgtgacaagatgatgtgtcaaaacagagttgtacagcatggcattcaa
gttcggttgcaagtgttcaacacagagaagaagggttggggcgtccgctgcctggatgat
atcgacaaggggacgtttgtttgtacttactcaggcaggttaatgagcagagctgaagtt
caagagttgggaggtgctgatcaagacttgaaagaggagagcgctgtgaatgacagggca
aagctttttttccaaaaaagaaaacttgactctagctgttcagactctgagattgaactc
gtgcagactggcaaagatgatattcttgagcagcaggaaccttcttctgataatgaaaat
gaatcagctctaattcatccaaggaatgtgaaaactgcagctgtgagaaggcttggaact
agaatagctgttgtggataatcaccagctgaaaatggaggttgatactctggtgcacagt
gccagctcagatgaagataatatttctcagcctcagcattcaagcaaaacagaactgacc
agtggaacaaacaaagaaaaagaaagatccatccagaagcagaaggaagaagatctggtg
gaagttggacagacggagcctgctgagatgggcagtgcagaatgcagaaggaagagtctg
tctctgaagggtgttgcttgtggcagatcagatgtgctgaatgataaatacgttgtgaag
ccgtccacaaaggttccaaaaaaagctaactgcaaagaggaagctcacagacagtcaaaa
caaggcataatttgtatggatgcagatggtgacaggacgcttctgaagaatgctaatgat
gaaaatatctatatactagatgccacgaaagaaggaaatgtgggtcgttttcttaatcac
agctgctgccccaatctctttgcacagagtgtgtttgtagagactcacaacagaagtttc
ccatgggttgctttcttcacaaacaggcatgtgaaagctggaactgaactcacgtgggat
tatggatatgaagctggaagtatgccagagacagagatttcctgttggtgtggagttcag
aaatgcaggaagaaaaccttagcaggcggagggagcgggattcgaaccggtgaccccagc
tctaccacgcctaaaggcgcggggatgagccgagagccgctccctcaccacacgaccctc
acacctccaatccccgcccgcattccgtacaccagccaatcggccgctcgaagcaccacc
ccgtcgccccgcgctgcgggccggcccgtgcctttttgccggtcccgccgggccggtaag
cactgcggcgcgtggaacgaaagtgttagggagtggctgagggcctccggcgcagcgagg
ccgagtgcctcgggagcgggggagagtcgggagccgatgaggagccctgcgattatctcc
gtaacgttgaacggctgtgagaagggacggaccagtcggtccgtccatctgcttaaaaaa
attgtggaaacatttcctgtgtggcaagcagacggtggatttgttgtggaagccttgcgt
cttcctgttccaggtgctctccaggcgatggccaaaatggtgagaaggacgtgtgctttc
tgttcagaaggggaggctgcttctataatgtatgttgccaaagagcaaaatattgcagct
catcagagttgtttgttattttcctctggatttgtggaatctgaagagtataacccagaa
aatctagatttaaggtttgatgtggaatccgtgttgaatgaactcaagagaggaaagcga
ctggtgtgcaatttctgtcgcaagaaaggagccacagtgggatgtgaggagagagcctgc
cgcaggagttaccactacttctgtgccttgtgtgatgatgcagccatagaaacagatgaa
gtaaatggagtctaccgagtgttctgctcaaaacatgacccaggcaacaggaccaatcac
tatgatgcagctaataagaggaaaagacatgcatcgaaatcttccaccaccatggaacaa
atgagggcagaagagacagcagaagataacagattacggatattaagaaggaaaagcagc
agacacaaagtccgaatcgactttctcaggaaatgcaaacaagctgggcttctggatgac
atatttgaagaaatgttggacacccttcacttggcacaggaaaagctgatggatgacaac
acttcagagacagagtatgaggagacggtaatatcgctctttgactgcggactgtttgaa
aacatactgacaaatattcattcagggactgaggaaaaaattcaagaattgctgaaaagc
aggaaaagactggataaccagattgagctactgcaggagttaaaagaagtttctctcccc
tcccaagagagtactgccagtacatccagtacagtgtctgagtaa

DBGET integrated database retrieval system