KEGG   Meleagris gallopavo (turkey): 100550711Help
Entry
100550711         CDS       T01523                                 

Definition
hexosaminidase D-like
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100550711
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     100550711
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
16
AA seq 560 aa AA seqDB search
MAFQRSHKLNLLRIAVLLLVALAGIKFLFRDSLTLQLHKHISKDSTFWGDARDSGPQSQA
VEVQPAKIMAPRQGPKQQFPKDLSATEMRLVHLDLKGAAPRVSYLEQLFPLLSRLGANGI
LIEYEDMFPFKGELEVLKSPYAYSEEDVEWIQQLAELHKLEVVPLVQTFGHVEFILKHPK
YQHLREVERFPNSFNPHVPDTLALLKVILSQVMEKHRRSSWIHIGADEVFHLGEGKDSRN
WMSRNKGDTGTIYLKHIKEVLDFISTQYRGLRVLMWDDMLRKISVGALQESGIAKHVSPV
VWFYAPDFDAEQIGQFITKYLESGFEAVWFASAFKGTTGPTQSWPPLSSHLKNQLSWLRV
REAMPRFAPLRFQGIVLTGWQRYDHYSVLCELLPVGIPSLAICLQTVVNGGFTEETRRKV
LEVLGFQNMQLEQSTCEGRGVFPGAEIYHMVEQVNRQLKESITKMLEEESAIKGWFSPYH
RKHQFGNPRNMESFGSKVLKLHEDWESFVRDLRARLEGIYFPDTVEEWMEENVNPYLDPL
RDLVRDYRAIIRLNAQPKAP
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggccttccagcggagccacaagctgaacctgctgcgcattgccgtgctgctcctcgtg
gccttggctggcatcaagttcctcttccgtgacagcttaaccctgcagctgcacaagcac
atcagcaaggacagcacgttctggggggatgcgcgggactctggcccccagagccaggct
gtggaggtccaacctgcaaagatcatggccccaaggcagggacctaagcagcagttcccc
aaggacctcagtgccaccgagatgaggctcgttcacctggacttgaagggagctgctccc
agggtctcctatctggagcagttgttcccactcctgtcccggctgggagctaacgggatc
ctgatcgaatacgaggatatgttccccttcaagggggagctggaggtcctcaagtccccc
tatgcttacagtgaggaggacgttgagtggatccagcagctggcagagctccacaagctg
gaggtggttcccctggtgcagaccttcggtcacgtggagttcatcctcaaacaccccaag
taccagcacctgcgggaggtggagcgcttccccaacagcttcaatccccatgttccagac
accctggcattgctcaaggtcatcctatcacaggtgatggagaagcacaggcgctcctcg
tggatccacattggtgcagatgaggtgttccacctcggagaggggaaggactccaggaat
tggatgagccgcaacaagggtgacacaggaaccatatacctgaagcacattaaggaggtg
ctggacttcatctccacacagtaccggggactgcgggtgctcatgtgggacgacatgctg
aggaagatcagtgtgggagccctgcaggagtctgggatagcaaagcatgtctcacctgtg
gtgtggttctatgcacctgacttcgacgcagagcagattgggcagttcatcaccaagtac
ctggagagcggctttgaggccgtgtggtttgccagtgccttcaaaggcaccaccggccca
acacagagctggcctccgctgagctcccacctgaagaaccagctcagctggctgcgggtg
cgtgaggccatgccgcgttttgccccgctgcgcttccagggcattgtcctcaccgggtgg
cagaggtacgaccactattcagtgctgtgtgagctgctgcctgttggcattccctccctg
gccatatgcctccagaccgtggtgaatgggggattcacggaagagacgcggaggaaggtg
ctggaggtgttgggcttccagaacatgcagctggagcagagcacatgtgaaggaagggga
gtgttccctggggcagaaatctatcacatggtggagcaggtgaacagacagctgaaggag
agcatcaccaaaatgctggaggaggaaagtgccatcaagggctggttcagcccttaccac
cgcaagcaccagtttggcaatcctcgcaacatggagagctttggcagcaaggtgctcaag
ctccatgaggactgggagagctttgtccgggacctgcgtgcccgcctggagggtatctac
ttccctgacacagtggaggagtggatggaggagaatgtcaacccctacctggaccctctg
cgggacctggtccgggactaccgtgccatcatccgcctcaacgcccagcccaaggcacct
tag

DBGET integrated database retrieval system