KEGG   Meleagris gallopavo (turkey): 100550711Help
Entry
100550711         CDS       T01523                                 

Definition
hexosaminidase D-like
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Other glycan degradation
Class
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:mgp00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
16
AA seq 560 aa AA seqDB search
MAFQRSHKLNLLRIAVLLLVALAGIKFLFRDSLTLQLHKHISKDSTFWGDARDSGPQSQA
VEVQPAKIMAPRQGPKQQFPKDLSATEMRLVHLDLKGAAPRVSYLEQLFPLLSRLGANGI
LIEYEDMFPFKGELEVLKSPYAYSEEDVEWIQQLAELHKLEVVPLVQTFGHVEFILKHPK
YQHLREVERFPNSFNPHVPDTLALLKVILSQVMEKHRRSSWIHIGADEVFHLGEGKDSRN
WMSRNKGDTGTIYLKHIKEVLDFISTQYRGLRVLMWDDMLRKISVGALQESGIAKHVSPV
VWFYAPDFDAEQIGQFITKYLESGFEAVWFASAFKGTTGPTQSWPPLSSHLKNQLSWLRV
REAMPRFAPLRFQGIVLTGWQRYDHYSVLCELLPVGIPSLAICLQTVVNGGFTEETRRKV
LEVLGFQNMQLEQSTCEGRGVFPGAEIYHMVEQVNRQLKESITKMLEEESAIKGWFSPYH
RKHQFGNPRNMESFGSKVLKLHEDWESFVRDLRARLEGIYFPDTVEEWMEENVNPYLDPL
RDLVRDYRAIIRLNAQPKAP
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggccttccagcggagccacaagctgaacctgctgcgcattgccgtgctgctcctcgtg
gccttggctggcatcaagttcctcttccgtgacagcttaaccctgcagctgcacaagcac
atcagcaaggacagcacgttctggggggatgcgcgggactctggcccccagagccaggct
gtggaggtccaacctgcaaagatcatggccccaaggcagggacctaagcagcagttcccc
aaggacctcagtgccaccgagatgaggctcgttcacctggacttgaagggagctgctccc
agggtctcctatctggagcagttgttcccactcctgtcccggctgggagctaacgggatc
ctgatcgaatacgaggatatgttccccttcaagggggagctggaggtcctcaagtccccc
tatgcttacagtgaggaggacgttgagtggatccagcagctggcagagctccacaagctg
gaggtggttcccctggtgcagaccttcggtcacgtggagttcatcctcaaacaccccaag
taccagcacctgcgggaggtggagcgcttccccaacagcttcaatccccatgttccagac
accctggcattgctcaaggtcatcctatcacaggtgatggagaagcacaggcgctcctcg
tggatccacattggtgcagatgaggtgttccacctcggagaggggaaggactccaggaat
tggatgagccgcaacaagggtgacacaggaaccatatacctgaagcacattaaggaggtg
ctggacttcatctccacacagtaccggggactgcgggtgctcatgtgggacgacatgctg
aggaagatcagtgtgggagccctgcaggagtctgggatagcaaagcatgtctcacctgtg
gtgtggttctatgcacctgacttcgacgcagagcagattgggcagttcatcaccaagtac
ctggagagcggctttgaggccgtgtggtttgccagtgccttcaaaggcaccaccggccca
acacagagctggcctccgctgagctcccacctgaagaaccagctcagctggctgcgggtg
cgtgaggccatgccgcgttttgccccgctgcgcttccagggcattgtcctcaccgggtgg
cagaggtacgaccactattcagtgctgtgtgagctgctgcctgttggcattccctccctg
gccatatgcctccagaccgtggtgaatgggggattcacggaagagacgcggaggaaggtg
ctggaggtgttgggcttccagaacatgcagctggagcagagcacatgtgaaggaagggga
gtgttccctggggcagaaatctatcacatggtggagcaggtgaacagacagctgaaggag
agcatcaccaaaatgctggaggaggaaagtgccatcaagggctggttcagcccttaccac
cgcaagcaccagtttggcaatcctcgcaacatggagagctttggcagcaaggtgctcaag
ctccatgaggactgggagagctttgtccgggacctgcgtgcccgcctggagggtatctac
ttccctgacacagtggaggagtggatggaggagaatgtcaacccctacctggaccctctg
cgggacctggtccgggactaccgtgccatcatccgcctcaacgcccagcccaaggcacct
tag

DBGET integrated database retrieval system