KEGG   Meleagris gallopavo (turkey): 100550782Help
Entry
100550782         CDS       T01523                                 

Definition
serine/threonine-protein phosphatase PP1-alpha catalytic subunit-like
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mRNA surveillance pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Focal adhesion
Regulation of actin cytoskeleton
Insulin signaling pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    100550782
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100550782
  Cell growth and death
   04114 Oocyte meiosis
    100550782
  Cell communication
   04510 Focal adhesion
    100550782
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100550782
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100550782
   04270 Vascular smooth muscle contraction
    100550782
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    100550782
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100550782
Protein phosphatases and associated proteins [BR:mgp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100550782
Transcription machinery [BR:mgp03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100550782
Spliceosome [BR:mgp03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100550782
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 343 aa AA seqDB search
MAAQAALMAQMAQVTQVEPVAQVAPLATPRTVQGSRPGKNVQLTENEIRGLCLKSREIFL
SQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLL
LAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDE
KIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTF
GAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDE
TLMCSFQILKPADKNKGKYGQFSGLNPAGRPVTPPRNSAKAKK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggcggcacaagcggcactgatggcacaaatggcacaagtgacgcaggtggagcccgtg
gcacaagtggcaccgctggccacccctcgcacagtacaaggctcacggccggggaagaac
gtacagctgacagagaacgagatacgggggctgtgcctgaagtcacgggagatattcctg
agccagcccattctgctggagctggaagcccccctcaagatctgtggtgacatccacggg
cagtactacgacttgctgcggctctttgagtatgggggctttccccccgagagcaactac
ctgtttctgggtgactacgtggaccggggcaaacagtcgctggagaccatctgcctgctg
ctggcctacaagatcaagtaccctgagaacttcttcctgctgcgtggcaaccatgaatgt
gctagcatcaaccgcatctatggcttctatgacgagtgcaagcggcgatacaacatcaag
ctgtggaagaccttcaccgactgcttcaactgcttgcccattgctgccattgtggatgag
aagatcttctgctgccatggagggctgtcccctgacctgcagtcgatggagcagatccgg
cgcatcatgcgacccacagacgtgcccgaccagggcctgctgtgtgatctgctctggtct
gaccctgacaaggatgtgcagggctggggtgagaacgaccgcggtgtctccttcaccttt
ggggctgaggtggtggccaagtttctgcacaagcatgacctggacctcatctgccgggca
caccaggtggtggaggatggctacgagttctttgccaagcgccagctcgtcaccctcttc
tctgcacccaactactgcggggagttcgacaacgcaggtgccatgatgagcgtggatgag
accctcatgtgctccttccagattctgaaaccggcagacaagaacaagggcaagtatggg
cagttcagtgggctgaaccccgctggccgccctgtcaccccgccgcgcaactctgcaaaa
gccaagaagtga

DBGET integrated database retrieval system