KEGG   Meleagris gallopavo (turkey): 100550821Help
Entry
100550821         CDS       T01523                                 

Gene name
WHSC1L1
Definition
Wolf-Hirschhorn syndrome candidate 1-like 1
Orthology
K11425  
histone-lysine N-methyltransferase NSD3 [EC:2.1.1.43]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:mgp00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
24
AA seq 1436 aa AA seqDB search
MDFSFSFMQGIMGNTIQQPPQLIDSANIRQEDAFDASSDIAEDGGQTPYEAALQQGFQYP
TPTAEDLPPIANGYPATINVYEPQAKFQTYSQYPNGSANGFGTVRNFSPPEYYHVENSNA
RPHEVLEKPSPPQPPPPPPSVSQTVIPKKTGSPEIKLKITKTIQNGRELFESSLCGDLLN
EVQASEYAKAKHEGRKEKRKKSSKHDSSRSEERKSHKIPKLEPEEQNRPNERLSMLSERP
REDAVLEEAPVQQFLPSLPTQASHDIKFQVGDLVWSKVGTYPWWPCMVSCDPQLDVHTKI
NTRGAREYHVQFFSNQPERAWVHEKRVREYKGHKQYEQLLAEAAKQASNHSEKQKIRKPR
PQRERAQWDIGIAHAEKALKMTREERIEQYTFIYIDKEPEEVLSKAKKTAASKSETKKNR
RPKPALNTQAEHGNVITGSPSSAELRRQSQRRQSSAEEEEPPPVKIAWKTAAARKSLPAS
ITMHNLDLQKCNMSPVVKIEQVFALQNAAGDGKLIDQFVYSTKGVGNKAEISVKGQEKLN
SSSSQRNEKATCNVQNASSPETTSGSAGSVEKKQQRRSIRTRSESEKSTEVVPKKKIKKE
QVEMVPLAAVKTGLQKGASEISDSCKPLKKRSRASTDVELTSSAYRDASDSDSRGLNDLQ
GSFGKRSDSPSAAVDADASDVQSVDSSLSRRGTGTNKKDTVCQICESSGESLVSCEGECC
STFHMECLGLKAMPEEKFFCTECKNGEHTCFSCKLPGKDVKRCSVSACGKFYHEACVRKF
ATALFESRGFRCPQHCCSACSVDKDIHKASKGRMVRCFRCPIAYHSGDGCIAAGSLFVSS
HILICSNHSKRNHSSSAVNVGFCFVCARGLVVQDHSDPLFSSYAYKSHYLLNESNRAELM
KLPMIPPPSSASKKKCEKGGKLLCCESCPASFHPECLNIDMPEGCWNCNDCKAGKKLRYK
QIVWVKLGNYRWWPAEICNPRSVPLNIQGLKHDIGDFPVFFFGSHDYYWVHQGRVFPYVE
GDKSFAEGQTSINKTFKKALEEAAKRFQELKAQRESKEALEIERNSRKPPPYKHIKSNKV
IGKVQIQVADLSEIPRCNCKPSDENPCGLESECLNRMLQYECHPQVCPAGERCQNQCFTK
RLYPDAEIIKTDRRGWGLRTKRNIKKGEFVNEYVGELIDEEECRLRIKRAHENSVTNFYM
LTVTKDRIIDAGPKGNYSRFMNHSCNPNCETQKWTVNGDIRVGLFALCDIPAGMELTFNY
NLDCLGNGRTECHCGAENCSGFLGVRPKTAFATANEEKVKNAKLKQKKRKIKTEQKQMHE
DNCFQCGDGGELVMCDKKDCPKAYHLLCLNLTQPPFGKWECPWHQCDICSNPAVSFCEFC
PHSFCKDHEKGALVASALDGRLCCSTHDPKSPVAPEYWNKIKCKLEPQSPVEEAKE
NT seq 4311 nt NT seq  +upstreamnt  +downstreamnt
atggatttctctttctctttcatgcaagggatcatgggaaacacaattcagcaaccacct
cagctcattgactcagccaacatccgccaggaggatgcctttgatgccagcagtgacatt
gctgaagatggtggacagacaccatacgaagctgccctacagcaaggctttcagtaccca
acacccacggcggaggatctgccccccattgctaacggctacccggccaccatcaacgtg
tacgaacctcaagccaaattccagacgtacagtcaatatcccaatggttctgccaatggt
tttggtacagttagaaactttagtcccccagagtattaccacgtggaaaactcgaatgcg
aggccacacgaagttctggaaaagccttcccctccgcagccacccccaccaccaccttca
gtttcacagacggtgattccaaagaagactggctcaccagaaatcaaactaaaaataacc
aaaactatccagaacggcagggaattgtttgagtcctctctttgtggggaccttttaaat
gaagtacaagcgagtgagtatgctaaggcaaaacatgaagggagaaaagagaaaaggaaa
aaaagtagcaagcatgactcttcccgatcggaagagcgcaagtcgcacaaaattccaaaa
ttagaaccagaggaacaaaatagaccaaatgagaggcttagcatgctgtctgaaaggcca
agagaagatgcagtgttggaggaagccccggtgcagcagttcttgccttctcttccaaca
caagccagccatgacatcaagtttcaggttggcgatctggtttggtccaaggtgggaaca
tacccatggtggccttgcatggtttcatgtgatccacagcttgatgttcataccaaaatc
aatacaagaggtgcccgtgaataccatgttcagttttttagcaaccagccagaacgggcg
tgggtgcacgagaagcgagttcgggagtacaaaggacacaaacaatacgagcagttattg
gcagaggctgctaagcaagccagcaaccattctgagaaacagaagattcgcaaaccaagg
ccacaaagagagcgtgctcagtgggatattggtattgcccacgctgagaaagcgttgaaa
atgactcgggaagaaaggatagaacaatacaccttcatttatatagacaaagagccagag
gaggttttgtcaaaagccaaaaagactgctgcttctaaatcggagaccaagaagaaccgg
cgtccaaagccagcgttgaacacccaggcagagcatggcaatgtgataacaggatcacct
tccagtgcagagctgcgaaggcagagccaacggaggcagtcgagtgcggaagaggaggag
ccaccacctgtgaaaattgcatggaaaacagctgcagctagaaaatccttaccagcctcg
ataaccatgcacaacttggatcttcaaaaatgtaacatgtctccggttgttaaaattgaa
caggtttttgctcttcaaaatgctgctggggatggaaaactcatcgatcagtttgtttat
tccactaagggagttggtaacaaagcagaaataagcgtcaaaggacaagagaagcttaat
tcttcatccagtcagaggaatgaaaaagcaacgtgcaatgtgcaaaacgcatcctctcct
gaaacaacttctgggtcagcaggttctgtagaaaagaagcaacagagaagatccattcga
acccgctcagagtctgagaaatccaccgaagttgtgccaaagaagaagatcaaaaaggag
caggttgaaatggttccactggcagcagtgaagacaggcctgcagaaaggtgccagcgag
atttcagattcttgtaaacctttaaagaagaggagtcgagcctcaactgatgtggaactg
acgagctcagcttacagagatgcttctgactctgattcaagaggactcaatgatttacag
ggtagttttggaaagcgttcggacagcccatcagctgctgtcgatgctgatgcttctgat
gtgcagtcagtggattccagcttatccaggagaggaactggaacaaataaaaaagacacc
gtttgtcagatctgtgagagctctggtgagtcactggtgtcctgtgagggcgagtgctgc
agcacctttcatatggagtgtctgggcctgaaggcgatgccggaggagaagttcttctgc
acagagtgtaaaaatggagaacacacgtgcttttcttgcaagcttcctggcaaagatgtg
aagcgctgctctgtcagcgcgtgcggtaaattctaccacgaggcgtgcgtgcgcaagttt
gccacagctctgtttgaatcacgaggatttcggtgccctcagcattgctgctctgcctgc
tccgtggataaggacatccataaagcaagcaaaggtcgcatggtgagatgtttcagatgt
cccattgcctatcactcaggagatggctgtattgctgcaggaagcttatttgtgtcatcc
cacattctcatctgtagtaaccattccaaaaggaatcactcctcatcagctgtaaatgta
ggcttttgtttcgtttgtgcaagagggctggtagtgcaggatcattcagaccccctgttc
agttcatatgcctataaatcccactacctactgaatgaatcaaatcgtgctgagttgatg
aaattacctatgattcctcctccttcgtcagcttccaaaaagaaatgtgagaaaggtgga
aaactgttgtgctgtgagtcctgcccagcttcctttcaccctgagtgtctcaacatagac
atgcctgaaggatgttggaattgcaatgactgtaaagctggcaagaagcttcgttacaag
cagattgtttgggtcaagcttggaaattacaggtggtggccagcagagatctgcaatccc
aggtctgtgcctctcaacatacagggcctcaaacatgatatcggggacttcccagtattt
ttctttggttcacatgactactattgggtacaccagggcagagttttcccttatgttgaa
ggagataaaagctttgctgaggggcaaactagtattaacaagaccttcaagaaagcactt
gaagaagcagcaaagcgtttccaggagctgaaagcacaaagagaaagcaaagaagcatta
gaaattgaaagaaattcaaggaaacctccaccatataaacacattaaatccaacaaggta
atagggaaggttcagattcaggtggctgacctgtcagaaatcccccgctgtaactgcaag
ccatctgatgagaacccgtgtggtctggagtcagaatgtctgaacaggatgctgcagtat
gagtgccacccccaggtgtgcccagcaggagagaggtgtcagaaccagtgcttcaccaaa
aggctctaccctgatgctgaaatcatcaaaaccgatcgacgtggatggggtctcaggaca
aaaaggaacattaaaaagggtgaatttgtgaatgaatacgttggggagctaattgatgaa
gaagagtgcagactgcgaattaaacgtgcccatgaaaacagtgtaaccaatttttatatg
ttaacagttacaaaggatcggataatagatgctggtccaaaggggaattattctcgcttt
atgaaccatagttgtaatccaaactgtgaaacacagaaatggacagtgaatggtgacatc
agagttgggctgtttgctctttgtgacattcctgcaggaatggagttaacatttaattat
aatttggattgccttgggaatggtaggactgagtgtcactgcggagcagaaaactgcagt
ggtttcctaggagtgcgtccaaagacagcatttgcaacagcaaatgaagagaaggtgaag
aatgcaaaattaaagcagaagaagcggaaaataaaaacggaacagaagcagatgcacgaa
gacaactgtttccagtgtggagatgggggagaacttgtcatgtgtgataaaaaggactgt
cccaaagcttaccacctcctatgccttaacctgactcaaccaccttttggaaagtgggaa
tgtccgtggcatcagtgtgacatctgtagcaatcctgcagtttcgttctgtgagttctgc
cctcattcattctgtaaggatcacgagaaaggagccctggtggcatcggcactggacggc
cgtctctgctgctccacacatgaccccaaatctcccgtggcacctgagtactggaacaag
ataaaatgcaaattggaacctcagagtcctgtagaagaagcaaaagagtga

DBGET integrated database retrieval system